Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) AT3G62950 135 / 7e-43 Thioredoxin superfamily protein (.1) AT2G47870 133 / 5e-42 Thioredoxin superfamily protein (.1) AT4G15680 128 / 4e-40 Thioredoxin superfamily protein (.1) AT4G15700 127 / 1e-39 Thioredoxin superfamily protein (.1) AT4G15660 127 / 2e-39 Thioredoxin superfamily protein (.1) AT4G15670 126 / 2e-39 Thioredoxin superfamily protein (.1) AT5G18600 123 / 3e-38 Thioredoxin superfamily protein (.1) AT4G15690 122 / 1e-37 Thioredoxin superfamily protein (.1) AT2G30540 117 / 1e-35 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040898 [exp] 136 / 4e-43 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 135 / 6e-43 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 124 / 3e-38 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 122 / 2e-37 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 121 / 2e-36 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 111 / 6e-33 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10029440 [exp] 105 / 7e-31 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 105 / 1e-30 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 105 / 1e-30 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G214500 [exp] 191 / 7e-65 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.014G134200 [exp] 146 / 4e-47 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 144 / 3e-46 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 133 / 1e-41 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 132 / 1e-41 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 130 / 5e-41 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 130 / 5e-41 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 129 / 3e-40 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 127 / 1e-39 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.014G134300 [exp] 127 / 2e-39 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10012815 pacid=23142364 polypeptide=Lus10012815 locus=Lus10012815.g ID=Lus10012815.BGIv1.0 annot-version=v1.0 ATGGATAAGGTGGCGAGGTTGGCGTCCCAAAGGGCGGTGGTGATATTCAGCAAGAGCACGTGCTACATGTGCCACGCCATCAAGCGGCTCTTCTACGAGC AAGGGGTCAGCCCGGCTATCCACGAGCTCGACGAGGACCCACGTGGCAAAGAGATGGAGTGGGCCCTTGTCCAGCTCGGTTGCAACCCTTCCATCCCCGC GGTGTTCATTGGCGGCAAGTTCATAGGCTCAGCCAACACGGTCATGACCCAGCAGCTCAACGGCTCGCTCAAGAAGCTGCTCAAGGAAGCCGGAGCCATG TGGCTTTAG
AA sequence Show only first row Show all	>Lus10012815 pacid=23142364 polypeptide=Lus10012815 locus=Lus10012815.g ID=Lus10012815.BGIv1.0 annot-version=v1.0 MDKVARLASQRAVVIFSKSTCYMCHAIKRLFYEQGVSPAIHELDEDPRGKEMEWALVQLGCNPSIPAVFIGGKFIGSANTVMTQQLNGSLKKLLKEAGAM WL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G21460			Glutaredoxin family protein (....		Lus10012815 [exp]	0	1
AT5G18600			Thioredoxin superfamily protei...		Lus10033965 [exp]	2.0	0.9233
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10032169 [exp]	2.4	0.9303
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10017668 [exp]	2.8	0.9148
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10014518 [exp]	6.5	0.9191
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10015843 [exp]	8.4	0.9084
AT3G20410		CPK9	calmodulin-domain protein kina...		Lus10032640 [exp]	8.8	0.8965
AT1G78410			VQ motif-containing protein (....		Lus10038502 [exp]	11.0	0.8828
AT1G24620			EF hand calcium-binding protei...		Lus10007816 [exp]	11.5	0.9080
AT5G19040		ATIPT5	Arabidopsis thaliana ISOPENTEN...		Lus10004428 [exp]	12.4	0.8690
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Lus10036539 [exp]	13.0	0.8792

Compare expression of checked genes

Lus10012815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.