Lus10012820 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14205 182 / 2e-59 Ribosomal L18p/L5e family protein (.1)
AT1G48350 77 / 8e-18 EMB3105 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030465 270 / 5e-94 AT1G14205 174 / 2e-56 Ribosomal L18p/L5e family protein (.1)
Lus10039092 72 / 3e-16 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10038770 72 / 4e-16 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G087100 186 / 8e-61 AT1G14205 202 / 2e-67 Ribosomal L18p/L5e family protein (.1)
Potri.010G005000 74 / 9e-17 AT1G48350 229 / 4e-78 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10012820 pacid=23163033 polypeptide=Lus10012820 locus=Lus10012820.g ID=Lus10012820.BGIv1.0 annot-version=v1.0
ATGGAGCTTTTGACCGTTCCCAAACCAACTCTCCATTTCAGAATTTCTACCATCTTCGTTAGCCATTTGAAGCTTTTAAATTCAAACCCCCTGCCTATCC
AACTACAGAGATTCCGAGGGATGAGCTTGGTTGCGAGTTCAAGGAAGAACACCAGAACAGAGAGCGCTAAAACCCTTAACAGGAGGAGGCAACACAAGTT
CAACGGGACGCCTTCGAAGCCGAGGCTGTCGGTGTTCAGTTCAGGGAAGCAGCTGTATGCAATGCTGGTGGATGATAAGAACAAGAAGAGCTTGTTCTAC
GGGAGCACCTTGCAGAAGTCGATTCGTGGCGACCCGCCTTGTTCCACCATTGAAGCTGCTGAAAGATTGGGTGAGGAGGTGATCAAGGCGTGTGTCAAGC
TCGAGATCGTGGAAGTGTCGTACGATCGGAATGGGAATCCGGCTCGTGGGGAGAAGATACAGGCGTTCGAGACTGTGATTTCTCGACACGGGTTCTTGCC
CGATCGAGCGACTAGGTCTCGACGGGTTCCTGCCACATCGCCTTAG
AA sequence
>Lus10012820 pacid=23163033 polypeptide=Lus10012820 locus=Lus10012820.g ID=Lus10012820.BGIv1.0 annot-version=v1.0
MELLTVPKPTLHFRISTIFVSHLKLLNSNPLPIQLQRFRGMSLVASSRKNTRTESAKTLNRRRQHKFNGTPSKPRLSVFSSGKQLYAMLVDDKNKKSLFY
GSTLQKSIRGDPPCSTIEAAERLGEEVIKACVKLEIVEVSYDRNGNPARGEKIQAFETVISRHGFLPDRATRSRRVPATSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14205 Ribosomal L18p/L5e family prot... Lus10012820 0 1
AT1G14550 Peroxidase superfamily protein... Lus10024209 2.0 0.9837
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10019915 2.8 0.9720
AT1G14550 Peroxidase superfamily protein... Lus10024205 3.5 0.9776
AT1G22810 AP2_ERF Integrase-type DNA-binding sup... Lus10009468 5.7 0.9558
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Lus10020550 7.1 0.9266
AT2G43610 Chitinase family protein (.1) Lus10025948 7.3 0.9236
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10036014 8.7 0.9731
AT1G55230 Family of unknown function (DU... Lus10039191 9.0 0.9356
AT5G39650 DAU2 DUO1-activated unknown 2, Prot... Lus10012821 9.5 0.9591
AT5G49630 AAP6 amino acid permease 6 (.1) Lus10007235 9.8 0.9643

Lus10012820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.