Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26880 182 / 7e-61 Ribosomal protein L34e superfamily protein (.1.2) AT1G69620 180 / 6e-60 RPL34 ribosomal protein L34 (.1) AT3G28900 176 / 1e-58 Ribosomal protein L34e superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042199 [exp] 191 / 3e-64 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10037177 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10030477 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10036750 [exp] 189 / 1e-63 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10008617 [exp] 188 / 4e-63 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G082200 [exp] 186 / 2e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108400 [exp] 186 / 2e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106466 [exp] 186 / 3e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106532 [exp] 186 / 3e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.001G195101 [exp] 177 / 5e-59 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2) Potri.004G029400 [exp] 164 / 1e-53 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108301 [exp] 107 / 1e-31 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01199 [flax] [poplar] Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence Show only first row Show all	>Lus10012829 pacid=23163031 polypeptide=Lus10012829 locus=Lus10012829.g ID=Lus10012829.BGIv1.0 annot-version=v1.0 ATGGTTCAGCGCCTAACTTACCGCAAGCGCCACAGCTATGCCACCAAGTCGAACCAGCACAGGATCGTCAAGACTCCTGGTGGTAAGTTGGTGTACCAGA CCACTAAGAAGAGAGCCAGTGGACCTAAGTGCCCTGTTACTGGAAAGAGGATTCAAGGGATTCCGCATTTGAGACCTGCTGAGTACAAGAGGTCCAGATT GCCGAGGAACAGGAGAACCGTTAACCGTGCTTATGGTGGCGTTCTCTCTGGTGGTGCTGTTCGTGAAAGGATCATCCGTGCTTTCCTTGTCGAAGAGCAG AAGATCGTAAAGAAGGTGTTGAAGATCCAGAAGTCCAAGGAGAAGGTCACTAAGTAG
AA sequence Show only first row Show all	>Lus10012829 pacid=23163031 polypeptide=Lus10012829 locus=Lus10012829.g ID=Lus10012829.BGIv1.0 annot-version=v1.0 MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQ KIVKKVLKIQKSKEKVTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26880			Ribosomal protein L34e superfa...		Lus10012829 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Lus10030477 [exp]	1.0	0.9881
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10026664 [exp]	1.7	0.9636
AT5G15200			Ribosomal protein S4 (.1.2)		Lus10012839 [exp]	2.0	0.9780
AT1G07770		RPS15A	ribosomal protein S15A (.1.2)		Lus10032503 [exp]	4.2	0.9399
AT2G44120			Ribosomal protein L30/L7 famil...		Lus10029423 [exp]	4.9	0.9612
AT5G28060			Ribosomal protein S24e family ...		Lus10000938 [exp]	7.1	0.9462
AT5G27700			Ribosomal protein S21e (.1)		Lus10031494 [exp]	8.5	0.9105
AT5G15200			Ribosomal protein S4 (.1.2)		Lus10030487 [exp]	12.0	0.9184
AT5G27850			Ribosomal protein L18e/L15 sup...		Lus10041264 [exp]	12.7	0.9306
AT2G03590		ATUPS1	ureide permease 1 (.1)		Lus10037074 [exp]	17.2	0.9285

Compare expression of checked genes

Lus10012829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.