Lus10012834 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57550 287 / 4e-97 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G25810 284 / 8e-96 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 277 / 4e-93 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 255 / 1e-84 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57540 248 / 1e-81 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 247 / 2e-81 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT4G25820 246 / 3e-81 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT2G18800 244 / 7e-80 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G14130 241 / 5e-79 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 240 / 2e-78 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030484 390 / 1e-137 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Lus10010938 248 / 8e-82 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 247 / 3e-81 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 246 / 7e-81 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 246 / 8e-81 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 241 / 5e-79 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10000678 236 / 4e-77 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 234 / 2e-76 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 234 / 2e-76 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G094800 287 / 5e-97 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 286 / 7e-96 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G007200 279 / 6e-94 AT4G25810 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 277 / 5e-93 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 273 / 1e-91 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G071200 266 / 7e-89 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094900 265 / 2e-88 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.002G060500 253 / 2e-83 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 252 / 2e-83 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 251 / 4e-83 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10012834 pacid=23163025 polypeptide=Lus10012834 locus=Lus10012834.g ID=Lus10012834.BGIv1.0 annot-version=v1.0
ATGGCGACTCCCACCTCCAACACCCCTTTCCTACTCCTCTCAATCACCCTCATCATCTCTGCCACCGCCACCTTTGCGGCCCAGACCGATCTGGGCCGCG
AATTCGACCTCACGTGGGGAGAAGGCCGCGGTAAGATCGTTGCTGACGGCCAGCTCCTCACCCTGACCCTCGACCACACGTCCGGATCAGGGTTCCAGTC
CAAGAACAAGTACCTATACGGGAAGCTCGACATGCAGCTCAAGCTCGTCCCCGGCAACTCCGCCGGCACGGTCACTGCTTACTTTGTAATAAAGACTGAA
TCTTCTCTCCACTTTTTGCCATGGATTTGCAAAAAGATTGCATCTTTTCTTCATTTCTGCCATGAACTTGCAGAAAGATTGTTGAAGTCTGATGGAGGTG
CGTGGGACGAGATTGACTATGAGTTCTTGGGGAACTTGAGTGGCGATCCTTATACGGTTCATACAAACGTATTCACAAACGGGAAAGGCGACCGGGAGCA
GCAGTTTCGTCTTTGGTTCGATCCAACGACTGATTTTCATACTTATTCCATCCTTTGGAACCCCAAGAGCATCGTGGAGAGTAGAGTCAATTGGTTAGTA
GTCCAAGTTGGTAGTACAGTTGGTAGGGACTGGTCACAGGCTCCGTTCTCAGCCTCCTACAAAGACTTTAGAGCAGGGGAGGCCTGCATATGGAAGGACG
GCGAAGCGACGTCGTCTTGCTCTCCAGCGGGTAGCACGTCGTGGCTGAGCGAGCAGCTGAACTCGGTGAATGAGCAGCGGATGAGGTGGGTCCAGAGCCA
TTACATGATCTACAACTACTGTACTGATTCCAAGAGGTTCCCTCAAGGGTTCCCTAAAGAGTGCGGTGTAGAATAA
AA sequence
>Lus10012834 pacid=23163025 polypeptide=Lus10012834 locus=Lus10012834.g ID=Lus10012834.BGIv1.0 annot-version=v1.0
MATPTSNTPFLLLSITLIISATATFAAQTDLGREFDLTWGEGRGKIVADGQLLTLTLDHTSGSGFQSKNKYLYGKLDMQLKLVPGNSAGTVTAYFVIKTE
SSLHFLPWICKKIASFLHFCHELAERLLKSDGGAWDEIDYEFLGNLSGDPYTVHTNVFTNGKGDREQQFRLWFDPTTDFHTYSILWNPKSIVESRVNWLV
VQVGSTVGRDWSQAPFSASYKDFRAGEACIWKDGEATSSCSPAGSTSWLSEQLNSVNEQRMRWVQSHYMIYNYCTDSKRFPQGFPKECGVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57550 XTR3, XTH25, EX... xyloglucan endotransglycosylas... Lus10012834 0 1
AT1G44224 ECA1 gametogenesis related fam... Lus10018644 1.4 0.6861
AT4G23210 HIG1, CRK13 cysteine-rich RLK (RECEPTOR-li... Lus10003735 18.0 0.6277
AT4G17500 AP2_ERF ATERF-1, AtERF1 ethylene responsive element bi... Lus10040165 28.8 0.6623
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Lus10041259 31.4 0.6010
AT2G27710 60S acidic ribosomal protein f... Lus10019846 45.4 0.6434
AT1G71520 AP2_ERF Integrase-type DNA-binding sup... Lus10006179 70.8 0.5559
AT5G13080 WRKY ATWRKY75, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Lus10012547 90.6 0.5871
AT3G22640 PAP85 cupin family protein (.1) Lus10042617 117.2 0.5442
AT3G14130 Aldolase-type TIM barrel famil... Lus10008133 117.7 0.5622
AT1G51410 NAD(P)-binding Rossmann-fold s... Lus10009955 137.7 0.4918

Lus10012834 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.