Lus10012846 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42010 74 / 5e-15 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G53500 71 / 2e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G24320 68 / 3e-13 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT1G64610 58 / 8e-10 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G54200 58 / 1e-09 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G15470 49 / 1e-06 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G02430 48 / 2e-06 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G37670 46 / 9e-06 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011313 336 / 2e-116 AT5G53500 129 / 1e-32 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10000387 297 / 7e-102 AT5G02430 53 / 1e-14 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003206 218 / 1e-67 AT1G64610 427 / 1e-141 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017902 197 / 1e-64 AT5G53500 58 / 3e-10 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10017312 209 / 9e-64 AT1G64610 439 / 4e-146 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 180 / 1e-52 AT5G24320 516 / 1e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023033 177 / 2e-51 AT5G24320 508 / 3e-171 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023577 123 / 1e-35 AT5G24320 50 / 7e-08 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10038684 89 / 9e-21 AT3G54940 499 / 1e-177 Papain family cysteine protease (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G144400 134 / 2e-36 AT5G24320 516 / 4e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.001G086600 134 / 3e-36 AT5G24320 514 / 1e-173 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.015G009700 94 / 6e-22 AT5G24320 621 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.012G018200 85 / 5e-19 AT5G24320 606 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 81 / 9e-18 AT5G53500 523 / 1e-177 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G057600 70 / 7e-14 AT5G24320 384 / 3e-124 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G110500 69 / 2e-13 AT5G24320 411 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.011G122500 52 / 9e-08 AT3G15470 835 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.010G228400 51 / 2e-07 AT3G54940 501 / 6e-179 Papain family cysteine protease (.2)
Potri.006G084600 50 / 4e-07 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10012846 pacid=23163013 polypeptide=Lus10012846 locus=Lus10012846.g ID=Lus10012846.BGIv1.0 annot-version=v1.0
ATGATGGAGGGCAGAGCTGGTGAGGATGGTTTGTTTGCGGCGGAGGAGGAGGCGGAGACGATGGACACTAGCGGTTTGCCGGATGAGTTTGACTGGAGGG
ACAAAGGAGCTATAACCGACGTCCAGTTGCAGTACAATCCAGTGGATGAAGACTGCTTCATCACTGGATCTATAGATGGAAAAGATCGGATCTGGGAAGT
GTCTGGATATAATACGATGCGACAAGATGCTGTAGCATGTTCACAAAGGAAAACAAAACTGCCTGGCAAGAGAATAACCAGCTTTGAGATGCACTCCACT
TTTACTTCGGACGGTAAGAGTGTTGTCTTGACGAGCGACGACTGGAATGCCTACATATGGACCTACGACAAACAGGAGAAGCCGTCCTCTCGAGCTAAGC
TTATCCGCTCCTACGAGAGCTTCATTTCCCCTAATGCATCGGTCGCAATACCTTGGCGTGGGATCGAAATTGAGCCAGCTGGCACAATCTCATCCCGACG
ACCCCAATCCGACCATAACCATCACAAGAGCATCATATCCTCGCCGTGTTGTTTCAACATCATTCGCTGGTTTTTGCTAGATTCTCTATCCAGGGGAGCT
GCAACTTGGCCAGAGTACTCAAATCAGAGTTGA
AA sequence
>Lus10012846 pacid=23163013 polypeptide=Lus10012846 locus=Lus10012846.g ID=Lus10012846.BGIv1.0 annot-version=v1.0
MMEGRAGEDGLFAAEEEAETMDTSGLPDEFDWRDKGAITDVQLQYNPVDEDCFITGSIDGKDRIWEVSGYNTMRQDAVACSQRKTKLPGKRITSFEMHST
FTSDGKSVVLTSDDWNAYIWTYDKQEKPSSRAKLIRSYESFISPNASVAIPWRGIEIEPAGTISSRRPQSDHNHHKSIISSPCCFNIIRWFLLDSLSRGA
ATWPEYSNQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53500 Transducin/WD40 repeat-like su... Lus10012846 0 1
AT1G79915 Putative methyltransferase fam... Lus10025778 3.2 0.8252
AT5G19370 rhodanese-like domain-containi... Lus10026105 6.9 0.8163
AT2G38140 PSRP4 plastid-specific ribosomal pro... Lus10004829 13.2 0.8333
AT2G40435 unknown protein Lus10017415 18.8 0.8105
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10009282 21.6 0.8208
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10015883 22.1 0.8213
AT3G09870 SAUR-like auxin-responsive pro... Lus10013819 30.6 0.8115
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10018763 30.8 0.8067
AT4G15620 Uncharacterised protein family... Lus10041528 31.9 0.8197
AT5G19370 rhodanese-like domain-containi... Lus10000413 33.9 0.7701

Lus10012846 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.