Lus10012852 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36930 99 / 3e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT5G17680 99 / 3e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G72840 95 / 1e-21 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
AT1G72920 90 / 7e-21 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT5G40100 91 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G72940 88 / 8e-20 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G72860 88 / 3e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G48770 86 / 1e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G69550 85 / 3e-18 disease resistance protein (TIR-NBS-LRR class) (.1)
AT3G04220 84 / 3e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030498 208 / 2e-67 AT5G36930 115 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10009500 136 / 1e-39 AT1G72940 115 / 4e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Lus10029921 124 / 4e-33 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10014671 112 / 1e-29 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10004482 112 / 4e-29 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10006929 111 / 4e-29 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Lus10012063 107 / 8e-28 AT5G36930 124 / 5e-34 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10012853 102 / 7e-27 AT3G22060 44 / 6e-06 Receptor-like protein kinase-related family protein (.1)
Lus10027920 106 / 2e-26 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G004500 96 / 1e-23 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002568 100 / 2e-23 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.006G269950 94 / 6e-23 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G001314 93 / 2e-22 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G021681 96 / 3e-22 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T001500 96 / 3e-22 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G017082 96 / 3e-22 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G097300 96 / 6e-22 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G003285 96 / 6e-22 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G019710 95 / 6e-22 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10012852 pacid=23162974 polypeptide=Lus10012852 locus=Lus10012852.g ID=Lus10012852.BGIv1.0 annot-version=v1.0
ATGGATCACTACATATCTTCATCTTCTTCCATTATTTCTCTTCCGGCCAAGCTCATCGTGGGATCCGCCATCCTGGTTTTACTGGTCGGATGTATTAGCC
GAGACATCCTCGTCGCCGGCCAATTATGCACCGGAGATCCACCACACCATCCGACCAAGTACAGATCTTGGGTAGGGAAGGCTCTAAAGAAACTAGTGAA
GGGAGCCCCTACGAGTTCGACGAAAATGATGAAAGCATATTACCCAAATAAAAAGGCTGGATCGGTTACCGGAGCGGCCACTTGTTACACCGCCGATGAA
GCCGCGTGCCGGACTTGTCTACAGAATAGCAAAATGCTGCTATTTCACTACTGCACGAACACCTCCGGTGGAAACTTCGATAACGGATGTAACATGGAGT
TCTGGGAAGTTGTTACAATTAATATGGGCTACCACGACGTATTTGTAAGCTTCCGAGGTCGGGACGTGCGGTACAAGTTCGTCGACCATCTCTTCGCCGC
ACTCCGGAGGAACAAAGTGACGGCGTTCAGGGATGATCGCAACTTACGCCGGGGAGAAAGCATCGAGGACGGTGTTCGAAGGGCCATCAAGAATTCAAGC
TTCTACGTCGTCGTTTTGACCCCCAACTACACTTCGTCTCCGTGGTGCTTGGATGAGCTTATCAAAAAGATGAAATGCTCCACTAATATTGATGGTGTTA
ACCGGAACAAAAATCCGTACACGAACGAAAGATTAGACACGTGGCTTCGGGCGCTTCATTGGATCGCCGGCATAGCTGGCTGGGTTGTCAGTGACGGGCA
GTGTGTCACATGTTTTGCGTATAATTGA
AA sequence
>Lus10012852 pacid=23162974 polypeptide=Lus10012852 locus=Lus10012852.g ID=Lus10012852.BGIv1.0 annot-version=v1.0
MDHYISSSSSIISLPAKLIVGSAILVLLVGCISRDILVAGQLCTGDPPHHPTKYRSWVGKALKKLVKGAPTSSTKMMKAYYPNKKAGSVTGAATCYTADE
AACRTCLQNSKMLLFHYCTNTSGGNFDNGCNMEFWEVVTINMGYHDVFVSFRGRDVRYKFVDHLFAALRRNKVTAFRDDRNLRRGESIEDGVRRAIKNSS
FYVVVLTPNYTSSPWCLDELIKKMKCSTNIDGVNRNKNPYTNERLDTWLRALHWIAGIAGWVVSDGQCVTCFAYN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G17680 disease resistance protein (TI... Lus10012852 0 1
AT3G15810 Protein of unknown function (D... Lus10006656 2.8 0.7343
AT5G25610 ATRD22, RD22 RESPONSIVE TO DESSICATION 22, ... Lus10024706 3.0 0.8134
AT3G24650 B3 SIS10, ABI3 SUGAR INSENSITIVE 10, ABSCISIC... Lus10011888 4.2 0.6746
AT3G16650 Transducin/WD40 repeat-like su... Lus10001473 4.6 0.7299
Lus10020479 6.0 0.7092
AT1G01490 Heavy metal transport/detoxifi... Lus10024672 8.1 0.7215
AT2G21610 PE11, ATPE11 A. THALIANA PECTINESTERASE 11,... Lus10042315 13.6 0.7099
AT5G09360 LAC14 laccase 14 (.1) Lus10026812 15.2 0.7280
AT5G52390 PAR1 protein (.1) Lus10040714 17.0 0.7044
AT3G44220 Late embryogenesis abundant (L... Lus10005214 28.7 0.6918

Lus10012852 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.