Lus10012853 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 41 / 7e-05 Receptor-like protein kinase-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012852 100 / 2e-26 AT5G17680 100 / 1e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10013254 52 / 2e-09 ND /
Lus10030499 53 / 3e-09 ND /
Lus10011438 48 / 5e-08 ND 35 / 0.004
Lus10034546 48 / 6e-08 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1)
Lus10030775 49 / 9e-08 ND /
Lus10013255 48 / 1e-07 ND /
Lus10028048 46 / 5e-07 ND /
Lus10003757 46 / 7e-07 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10012853 pacid=23163018 polypeptide=Lus10012853 locus=Lus10012853.g ID=Lus10012853.BGIv1.0 annot-version=v1.0
ATGAAACCCTTCATATTAACAGCAGCAACAGCTGTGGTTTCACTAGTCGTATTCCTTAGCCAACACACGGCCGTCGGACAACCCCAGCAGCCATGCAACA
CCATATCTCCTGCCGATCCAGTGACGTACAGCGAACACATGCACAATGTTCTGCGCCAGCTCGTGAGGCAAACCCCCGGTAGTTCGAAGAACATCTTCCA
GGCGTATTACCCGAACAGGAAGCCCGGATCCGTTACCGGTACCGCCACTTGCTACACCAACGCTGACCCGGAAGCGTGCCGGGCTTGCCTGCAGGATGTA
AAGGTGCAGTTGGGTCGGTGCGTTCGGTCTACCTCTGGCGGGTATTTCGAGGACCGGTGTAACATGCAGTTCTGGGAAATTGGAAGCATCGTCTGA
AA sequence
>Lus10012853 pacid=23163018 polypeptide=Lus10012853 locus=Lus10012853.g ID=Lus10012853.BGIv1.0 annot-version=v1.0
MKPFILTAATAVVSLVVFLSQHTAVGQPQQPCNTISPADPVTYSEHMHNVLRQLVRQTPGSSKNIFQAYYPNRKPGSVTGTATCYTNADPEACRACLQDV
KVQLGRCVRSTSGGYFEDRCNMQFWEIGSIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22060 Receptor-like protein kinase-r... Lus10012853 0 1
AT4G05220 Late embryogenesis abundant (L... Lus10007636 3.2 0.7173
AT5G16990 Zinc-binding dehydrogenase fam... Lus10007832 3.5 0.7057
AT5G61630 unknown protein Lus10032501 6.7 0.6119
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10032259 7.3 0.6634
AT3G52360 unknown protein Lus10029348 10.8 0.7232
AT5G04390 C2H2ZnF C2H2-type zinc finger family p... Lus10040425 15.0 0.6449
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Lus10032324 15.1 0.7150
Lus10003636 17.3 0.6857
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016224 19.4 0.6820
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Lus10018098 25.1 0.6613

Lus10012853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.