Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08710 134 / 7e-41 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 118 / 2e-34 Thioredoxin superfamily protein (.1) AT2G40790 115 / 2e-33 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G51030 98 / 4e-27 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G45145 86 / 3e-22 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G17880 90 / 1e-21 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT5G42980 84 / 2e-21 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 82 / 1e-20 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G39950 81 / 6e-20 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G11530 76 / 2e-18 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030505 [exp] 302 / 2e-106 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10029009 [exp] 211 / 5e-71 AT3G08710 126 / 5e-38 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10029090 [exp] 183 / 5e-60 AT3G08710 114 / 2e-33 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 139 / 1e-42 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10022727 [exp] 137 / 3e-42 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10041799 [exp] 96 / 4e-26 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 95 / 2e-25 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 91 / 3e-24 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 89 / 2e-23 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G110100 [exp] 151 / 1e-47 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 149 / 1e-46 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 147 / 9e-46 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 97 / 3e-26 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 94 / 2e-25 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 93 / 4e-25 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 95 / 1e-23 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 94 / 2e-23 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.004G031700 [exp] 78 / 4e-19 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 72 / 8e-17 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10012859 pacid=23162971 polypeptide=Lus10012859 locus=Lus10012859.g ID=Lus10012859.BGIv1.0 annot-version=v1.0 ATGAAAAGACGATGTTGCTGGCCAAAGACATTCAGCTGTAGAAGTTGTTACAATTTTAGGTGGTGTTGTAAATGTTCATACCACAGAGAAGATCGAGACC AAATCGACGCGAACGATAAGAATCTTCACATAGAGCTCGCCACGGGAAGGGTTCAACTTATAAGCACAGTACAAAAATGGGAAGACAAGCTCATAGAAGC GAAAACCCCCGGTAGGGTCGTTGTCCTTAACTTTAGTTCTTCGTGGAGCACCCCCTGTAGGTCGATAGCCCGACCGTATTGTAAGCTCGCGGACAAGTAT CCTTCGATCACGTTTCTGACAGTGGACGTAGACGCACTAGCTGAGATGAGCTCGACGTGGGAGGTTAAGGCGACGCCGACGTTCTTCTTCTTGAAAGAAG GGAAGCAGTTTGACAAACTTGTTGGTGCAAACAAGGTAGAGCTCAAGATGAAGATTGCTAACATTGATAGTCTTCCCTTGTAG
AA sequence Show only first row Show all	>Lus10012859 pacid=23162971 polypeptide=Lus10012859 locus=Lus10012859.g ID=Lus10012859.BGIv1.0 annot-version=v1.0 MKRRCCWPKTFSCRSCYNFRWCCKCSYHREDRDQIDANDKNLHIELATGRVQLISTVQKWEDKLIEAKTPGRVVVLNFSSSWSTPCRSIARPYCKLADKY PSITFLTVDVDALAEMSSTWEVKATPTFFFLKEGKQFDKLVGANKVELKMKIANIDSLPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10012859 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10031033 [exp]	2.6	0.9067
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10034957 [exp]	3.7	0.9067
AT1G70780			unknown protein		Lus10039287 [exp]	4.6	0.9067
AT2G33670		ATMLO5, MLO5	MILDEW RESISTANCE LOCUS O 5, S...		Lus10030729 [exp]	4.7	0.7672
					Lus10027606 [exp]	5.3	0.8911
AT2G14440			Leucine-rich repeat protein ki...		Lus10005049 [exp]	5.9	0.8790
AT4G37840		HKL3	hexokinase-like 3 (.1)		Lus10011584 [exp]	6.9	0.8386
AT5G24230			Lipase class 3-related protein...		Lus10022416 [exp]	6.9	0.8060
AT1G22710		SUT1, ATSUC2, S...	SUCROSE TRANSPORTER 1, ARABIDO...		Lus10022633 [exp]	7.1	0.7304
AT5G24130			unknown protein		Lus10001061 [exp]	8.5	0.7989

Compare expression of checked genes

Lus10012859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.