Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40780 48 / 5e-08 Nucleic acid-binding, OB-fold-like protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029014 [exp] 55 / 3e-10 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2) Lus10034249 [exp] 54 / 7e-10 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2) Lus10030510 [exp] 0 / 1 AT2G40780 155 / 5e-49 Nucleic acid-binding, OB-fold-like protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G080300 [exp] 38 / 0.0005 AT5G10070 367 / 3e-129 RNase L inhibitor protein-related (.1.2) Potri.019G061200 [exp] 0 / 1 AT2G40780 187 / 2e-61 Nucleic acid-binding, OB-fold-like protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012866 pacid=23163058 polypeptide=Lus10012866 locus=Lus10012866.g ID=Lus10012866.BGIv1.0 annot-version=v1.0 ATGGGGAAATATTTGTCACGCGCCAAGTTACGGACGTGGGAGCTTCGTGGTAGTCGACAGAAGTGGGAAGGAGATCGAGTCGGGAAGCAAGGTGACTTGC ATTGTTTCTCGGGTTCTCTTCCACGAACATGTCCGTACGCATGGCCTGAAGTCTTCAAAACCACAACCAATGGAACCTCTGATTCAAAAGGGACAGACCA AGAAGCAAAGGATCTCGATTCAAGCGACTGTGATGATGGGCTCCCGCCATTGAAAGCCAACATGAACAGAGTCCAGCCACCATTTCTAGAAGCTGACTCA GATACAGGATCTGATTCTGGTTCTTAG
AA sequence Show only first row Show all	>Lus10012866 pacid=23163058 polypeptide=Lus10012866 locus=Lus10012866.g ID=Lus10012866.BGIv1.0 annot-version=v1.0 MGKYLSRAKLRTWELRGSRQKWEGDRVGKQGDLHCFSGSLPRTCPYAWPEVFKTTTNGTSDSKGTDQEAKDLDSSDCDDGLPPLKANMNRVQPPFLEADS DTGSDSGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10012866 [exp]	0	1
					Lus10023136 [exp]	10.3	0.8277
AT3G49680		ATBCAT-3 ,BCAT3	branched-chain aminotransferas...		Lus10007246 [exp]	14.3	0.8249
AT4G30880			Bifunctional inhibitor/lipid-t...		Lus10016357 [exp]	17.9	0.8227
AT5G16600	MYB	ATMYB43	myb domain protein 43 (.1)		Lus10010974 [exp]	19.7	0.8080
					Lus10011497 [exp]	26.7	0.8057
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10026956 [exp]	29.9	0.7867
AT4G27390			unknown protein		Lus10037884 [exp]	35.2	0.7840
AT3G19010			2-oxoglutarate (2OG) and Fe(II...		Lus10004245 [exp]	40.2	0.7776
AT5G49720		TSD1, IRX2, DEC...	TUMOROUS SHOOT DEVELOPMENT 1, ...		Lus10028619 [exp]	41.6	0.7715
					Lus10022145 [exp]	43.8	0.7715

Compare expression of checked genes

Lus10012866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.