Lus10012875 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14620 324 / 2e-113 XTR2, EXGT-A2, DECOY decoy (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030524 441 / 1e-159 AT1G14620 333 / 6e-117 decoy (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G164800 333 / 5e-117 AT1G14620 300 / 5e-104 decoy (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0261 NUDIX PF11788 MRP-L46 39S mitochondrial ribosomal protein L46
Representative CDS sequence
>Lus10012875 pacid=23163017 polypeptide=Lus10012875 locus=Lus10012875.g ID=Lus10012875.BGIv1.0 annot-version=v1.0
ATGCGGCGGTCGTTGTCGTTGCTGCCCCGTCGTCTTCTGACGACGAGGGAGTTCTCTACCAGCAGCTCGGAGAAAATCGTAGCTTCCGTCCTCTTCGAGA
GGCTTCCCGTCGTCATCCCCAAAATCGACCCTGTCGTTTACGCTTTCCAGGAGTTCTCGTTTCGGTGGCGGCAGCAGTATAGCAGAAGATACCCGGATGA
GTTCTTGAACAAATCCAACTCCAGGGCACAAGGCGATTACCAAATAGACTATGTCCCAGCTCCAAGGATCACAAAAGCTGACGAAGCAAATGACAGAAAG
TCCCTTCAGAGGGCACTTGATAGAAGGCTGTACCTTCTTCTCCACGGAAAGGCTCATGGATCTCCCGATGACAAGCCTATCTGGCATTTCCCACAGAAGA
TTTATGATTCTGAAGAGACATTGCGCAAGTGTGCCGAGTCCGCATTGCAGTCTGTTTTAGGAGACCTATCCCACACATATTTCGTGGGAAACGCTCCTAT
GGGTCATTTGGTCGTGCAGCCCGAAGAAAAGCCACATGAACTCGGTTACAAGCAATTCTTTTTCAAGTCCCAGGTGATTGCGACGAATGAGTTCAAAATC
AGGAAGTGTGAGGATTTCGTGTGGGTGACCAAGGATGAACTGCTGGAGTTTTTTCCAGAGCATGCTGAGTTCTTCAAAAAGATGATCATCAGCTGA
AA sequence
>Lus10012875 pacid=23163017 polypeptide=Lus10012875 locus=Lus10012875.g ID=Lus10012875.BGIv1.0 annot-version=v1.0
MRRSLSLLPRRLLTTREFSTSSSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYSRRYPDEFLNKSNSRAQGDYQIDYVPAPRITKADEANDRK
SLQRALDRRLYLLLHGKAHGSPDDKPIWHFPQKIYDSEETLRKCAESALQSVLGDLSHTYFVGNAPMGHLVVQPEEKPHELGYKQFFFKSQVIATNEFKI
RKCEDFVWVTKDELLEFFPEHAEFFKKMIIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14620 XTR2, EXGT-A2, ... decoy (.1.2) Lus10012875 0 1
AT5G16950 unknown protein Lus10026852 1.7 0.8495
AT1G09590 Translation protein SH3-like f... Lus10021079 2.2 0.8787
AT1G18800 NRP2 NAP1-related protein 2 (.1) Lus10023599 2.8 0.8448
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031974 4.9 0.8526
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10038910 7.5 0.8335
AT4G29390 Ribosomal protein S30 family p... Lus10002508 8.1 0.8146
AT4G38370 Phosphoglycerate mutase family... Lus10014434 8.8 0.7971
AT1G03360 ATRRP4 ribosomal RNA processing 4 (.1... Lus10008171 11.7 0.8000
AT1G07070 Ribosomal protein L35Ae family... Lus10021121 15.0 0.8272
AT4G18100 Ribosomal protein L32e (.1) Lus10012195 15.7 0.8114

Lus10012875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.