Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51280 316 / 4e-106 DEAD-box protein abstrakt, putative (.1) AT4G33370 311 / 7e-105 DEA(D/H)-box RNA helicase family protein (.1) AT2G42520 144 / 5e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G58510 142 / 2e-39 DEA(D/H)-box RNA helicase family protein (.1), DEA(D/H)-box RNA helicase family protein (.2), DEA(D/H)-box RNA helicase family protein (.3) AT3G58570 141 / 4e-39 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G33730 125 / 2e-33 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G01540 123 / 1e-32 ATDRH1, DRH1 ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE 1, DEAD box RNA helicase 1 (.1.2.3.4) AT5G14610 122 / 3e-32 DEAD box RNA helicase family protein (.1.2) AT1G55150 121 / 3e-32 DEA(D/H)-box RNA helicase family protein (.1) AT5G63120 119 / 2e-31 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008856 [exp] 339 / 2e-115 AT5G51280 851 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10023252 [exp] 338 / 1e-114 AT5G51280 1015 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10015978 [exp] 144 / 1e-41 AT3G58570 535 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10000848 [exp] 144 / 4e-41 AT2G42520 655 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10001074 [exp] 142 / 2e-40 AT3G58570 533 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10015977 [exp] 142 / 3e-40 AT2G42520 738 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10015976 [exp] 143 / 5e-40 AT2G42520 849 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10030075 [exp] 142 / 2e-39 AT3G58570 603 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10016207 [exp] 140 / 6e-39 AT2G42520 850 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G047301 [exp] 319 / 8e-109 AT5G51280 520 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.004G224000 [exp] 320 / 1e-107 AT5G51280 1072 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.001G007900 [exp] 144 / 4e-40 AT2G42520 807 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.006G196000 [exp] 141 / 2e-39 AT3G58570 790 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.003G217800 [exp] 141 / 3e-39 AT2G42520 812 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.016G061900 [exp] 139 / 1e-38 AT2G42520 786 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G045800 [exp] 130 / 3e-35 AT2G33730 994 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G037200 [exp] 127 / 6e-34 AT2G33730 1058 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.019G130900 [exp] 122 / 2e-32 AT1G55150 321 / 2e-103 DEA(D/H)-box RNA helicase family protein (.1) Potri.013G158000 [exp] 121 / 3e-32 AT1G55150 322 / 3e-104 DEA(D/H)-box RNA helicase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00271 [flax] [poplar] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10012899 pacid=23163037 polypeptide=Lus10012899 locus=Lus10012899.g ID=Lus10012899.BGIv1.0 annot-version=v1.0 ATGCCGACCAAAATCCAGAACTTCGTGAAAACCGCTCTGGTAAAGCCAGTGATAGTCAACGTGGGGCGAACCGGTGCAGCAAATCTCGACGTGATTCAAG AATTTGAGTACGTGAAGCAGAACGCCAAGCTCGTTTACCTTCTCCAATGCATGCAGAAGACGCCTCCTCCGGTCTTGGTATTCTGCGAGAAGAAGCTTGA CTTGGACGCCATCCAAGAGTATCTCCTCCTTAAGGGAGTCGAGGCCGCCTCGATCCACGGAGATAAGTCCCAGTCGGACCGAGAGGAATCGATTAAACTC TTCAAAGCCGGCAAGAAAGACGTGGATGTCGCCTCGAAGGGATTAGATCTCCCTGAGATTCACCATGTGATCAACTACGACATGCCAGGTGAGACCGAGA ACTATGTACACAGGATCGGACGGACTGGAAGGTGTGGCAAGACTGGGATCGCTACGACTTTCATAAACAATACACAGAGCGAGACTACGTTACTCGATTT GAAGCATTTGTTGCAAGAGGCGAAACAGAGGATCCCGCCCATTCTGGCTGAGTTGAATGATCCAATTGACTTAATAGTTAATAACTAG
AA sequence Show only first row Show all	>Lus10012899 pacid=23163037 polypeptide=Lus10012899 locus=Lus10012899.g ID=Lus10012899.BGIv1.0 annot-version=v1.0 MPTKIQNFVKTALVKPVIVNVGRTGAANLDVIQEFEYVKQNAKLVYLLQCMQKTPPPVLVFCEKKLDLDAIQEYLLLKGVEAASIHGDKSQSDREESIKL FKAGKKDVDVASKGLDLPEIHHVINYDMPGETENYVHRIGRTGRCGKTGIATTFINNTQSETTLLDLKHLLQEAKQRIPPILAELNDPIDLIVNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51280			DEAD-box protein abstrakt, put...		Lus10012899 [exp]	0	1
AT4G37810			unknown protein		Lus10011591 [exp]	6.9	0.7443
					Lus10001007 [exp]	9.2	0.7858
AT3G25400			unknown protein		Lus10015730 [exp]	11.1	0.7400
AT5G04850		VPS60.2	SNF7 family protein (.1.2)		Lus10043454 [exp]	15.5	0.6765
AT1G67370		ASY1, ATASY1	ASYNAPTIC 1, DNA-binding HORMA...		Lus10040113 [exp]	16.2	0.7614
AT2G28490			RmlC-like cupins superfamily p...		Lus10006420 [exp]	16.9	0.6094
AT5G16610			unknown protein		Lus10010975 [exp]	18.7	0.7060
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10014726 [exp]	24.5	0.6810
AT3G48660			Protein of unknown function (D...		Lus10032028 [exp]	28.6	0.7240
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Lus10023568 [exp]	32.7	0.7229

Compare expression of checked genes

Lus10012899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.