Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51280 243 / 3e-78 DEAD-box protein abstrakt, putative (.1) AT4G33370 230 / 7e-74 DEA(D/H)-box RNA helicase family protein (.1) AT1G55150 103 / 1e-26 DEA(D/H)-box RNA helicase family protein (.1) AT2G47330 102 / 8e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G63120 97 / 3e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT1G20920 96 / 2e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT3G09620 93 / 1e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G33730 89 / 3e-21 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G31970 89 / 4e-21 STRS1 STRESS RESPONSE SUPPRESSOR 1, DEA(D/H)-box RNA helicase family protein (.1) AT3G01540 87 / 2e-20 ATDRH1, DRH1 ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE 1, DEAD box RNA helicase 1 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023252 [exp] 276 / 2e-91 AT5G51280 1015 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10008856 [exp] 229 / 2e-73 AT5G51280 851 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10037646 [exp] 106 / 2e-27 AT1G55150 843 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10015627 [exp] 106 / 2e-27 AT1G55150 845 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10037527 [exp] 101 / 2e-25 AT2G47330 1120 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10019484 [exp] 101 / 2e-25 AT5G63120 757 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10011466 [exp] 101 / 3e-25 AT2G47330 1110 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10043334 [exp] 100 / 3e-25 AT5G63120 752 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10001272 [exp] 94 / 8e-23 AT5G14610 665 / 0.0 DEAD box RNA helicase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G224000 [exp] 251 / 9e-82 AT5G51280 1072 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.005G047301 [exp] 148 / 3e-43 AT5G51280 520 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.003G038300 [exp] 107 / 5e-28 AT1G55150 790 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Potri.012G084600 [exp] 104 / 2e-26 AT5G63120 704 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.015G083000 [exp] 103 / 3e-26 AT5G63120 707 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.002G194600 [exp] 100 / 6e-25 AT2G47330 1048 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.002G003600 [exp] 94 / 5e-23 AT1G20920 1201 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.010G152400 [exp] 94 / 7e-23 AT3G06480 801 / 0.0 DEAD box RNA helicase family protein (.1) Potri.012G045800 [exp] 93 / 2e-22 AT2G33730 994 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G257400 [exp] 92 / 2e-22 AT1G20920 1253 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00270 [flax] [poplar] DEAD DEAD/DEAH box helicase
Representative CDS sequence Show only first row Show all	>Lus10012900 pacid=23162996 polypeptide=Lus10012900 locus=Lus10012900.g ID=Lus10012900.BGIv1.0 annot-version=v1.0 ATGAGGTTTCCTGAACCGATCTTGAGGAACTTGAAAGCTAAGGGGATTGTGCAGCCGACTCCAATTCAGGTTCAGGGGCTTCCCGTTATCCTATCCGGTA GAGACATGATCGGGATTGCGTTTACTGGTTCGGGGAAAACGCTGGTCTTTGTTCTTCTAATGATTATGATCGCCTTGCAGGAGGATTGTATGATGCATTT ACTACCAGGGGAAGGGCCCTTCGGGTTGGTTGTTTGTCCCACGATAGAACTCGCTAGGCAGACTTTTGACGTGGTAGAGCAGTTTTTGGCTCCGATGCGG GAGGCTGGATATCCTGAATTGAGAGCTATGCTTTGTACTGGCGGAGTTGAAATGAAATCGCAGCTGGTGATTGTGAAGAGAGGAGTGCATATTGTTGTTG CCACTCCGGGGAGGCTGAAAGATCTGCTCGTGAAGAAGAAGATGAATCTCGACAGTTGA
AA sequence Show only first row Show all	>Lus10012900 pacid=23162996 polypeptide=Lus10012900 locus=Lus10012900.g ID=Lus10012900.BGIv1.0 annot-version=v1.0 MRFPEPILRNLKAKGIVQPTPIQVQGLPVILSGRDMIGIAFTGSGKTLVFVLLMIMIALQEDCMMHLLPGEGPFGLVVCPTIELARQTFDVVEQFLAPMR EAGYPELRAMLCTGGVEMKSQLVIVKRGVHIVVATPGRLKDLLVKKKMNLDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51280			DEAD-box protein abstrakt, put...		Lus10012900 [exp]	0	1
					Lus10007927 [exp]	5.2	0.9599
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10040313 [exp]	7.2	0.8565
					Lus10023587 [exp]	7.3	0.9599
AT3G47800			Galactose mutarotase-like supe...		Lus10024242 [exp]	7.4	0.8496
AT2G37880			Protein of unknown function, D...		Lus10021495 [exp]	7.6	0.9138
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	9.0	0.9599
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	10.4	0.9599
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10039026 [exp]	11.6	0.9599
					Lus10043281 [exp]	11.7	0.8256
					Lus10007903 [exp]	12.0	0.8644

Compare expression of checked genes

Lus10012900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.