Lus10012914 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29410 181 / 2e-59 Ribosomal L28e protein family (.1.2)
AT2G19730 174 / 4e-57 Ribosomal L28e protein family (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012915 243 / 3e-84 AT4G29410 224 / 1e-76 Ribosomal L28e protein family (.1.2)
Lus10032699 233 / 7e-80 AT4G29410 219 / 1e-74 Ribosomal L28e protein family (.1.2)
Lus10006869 179 / 9e-59 AT2G19730 218 / 3e-74 Ribosomal L28e protein family (.1.2.3)
Lus10037609 177 / 4e-58 AT2G19730 221 / 2e-75 Ribosomal L28e protein family (.1.2.3)
Lus10032698 0 / 1 ND 134 / 1e-40
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G045500 189 / 1e-62 AT2G19730 230 / 3e-79 Ribosomal L28e protein family (.1.2.3)
Potri.001G194000 186 / 2e-61 AT2G19730 227 / 1e-77 Ribosomal L28e protein family (.1.2.3)
Potri.006G212501 45 / 4e-07 AT4G29410 45 / 2e-07 Ribosomal L28e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01778 Ribosomal_L28e Ribosomal L28e protein family
Representative CDS sequence
>Lus10012914 pacid=23158529 polypeptide=Lus10012914 locus=Lus10012914.g ID=Lus10012914.BGIv1.0 annot-version=v1.0
ATGGCCACAGTTCCAGGGCAGTTGATCTGGGAGGTTGTCAAGAGGAACAACTGCTTCCTCGTTAAACAATTCGGCCGTGGCAATGCCGGCCTCCGATTCA
GCAAGGAGAGCAACAATCTCTACAACCTCAACTCCTACAAGTACTCTGGTTTGGCAAACAAGAAAACTGTTTCCATCCAGCCGGAAGGCAAGGATTTAAC
TGTTGTACTGTCTACTACCAAGACCAAGAAGCAGAACAAGCCTGCCAATTTGAAGAACAAGTCAGTGATGAGGAAGGAGTTCCACTCCATGGCTAAGGCC
GTTGCTAATCAAGTTGGAGATAACTATTACCGTCCGGATCTGAAGAAGGCAGCCCTTGCTAGGCTCAGTGTTGTCCACAAGAGCCTTAAGGTTGCCAAGT
CCGGCCCCAAAAAGAGAACTAGGCAGGGGAGGAAGTGA
AA sequence
>Lus10012914 pacid=23158529 polypeptide=Lus10012914 locus=Lus10012914.g ID=Lus10012914.BGIv1.0 annot-version=v1.0
MATVPGQLIWEVVKRNNCFLVKQFGRGNAGLRFSKESNNLYNLNSYKYSGLANKKTVSIQPEGKDLTVVLSTTKTKKQNKPANLKNKSVMRKEFHSMAKA
VANQVGDNYYRPDLKKAALARLSVVHKSLKVAKSGPKKRTRQGRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29410 Ribosomal L28e protein family ... Lus10012914 0 1
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10038635 2.6 0.9390
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10027800 4.0 0.9527
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 7.6 0.9497
AT4G16720 Ribosomal protein L23/L15e fam... Lus10007805 9.9 0.9490
AT3G11510 Ribosomal protein S11 family p... Lus10022693 10.0 0.9433
AT1G67430 Ribosomal protein L22p/L17e fa... Lus10006421 11.8 0.9442
AT3G51800 ATEBP1, ATG2, E... A. THALIANA ERBB-3 BINDING PRO... Lus10005046 12.7 0.9421
AT5G02740 Ribosomal protein S24e family ... Lus10003991 12.7 0.9376
AT5G02610 Ribosomal L29 family protein ... Lus10019179 13.0 0.9374
AT1G48830 Ribosomal protein S7e family p... Lus10023638 15.7 0.9382

Lus10012914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.