Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29400 70 / 5e-16 Protein of unknown function (DUF3531) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032701 [exp] 97 / 7e-26 AT4G29400 307 / 1e-104 Protein of unknown function (DUF3531) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G148300 [exp] 72 / 1e-16 AT4G29400 337 / 1e-116 Protein of unknown function (DUF3531) (.1) Potri.010G255300 [exp] 37 / 0.0004 AT5G08400 438 / 4e-156 Protein of unknown function (DUF3531) (.1), Protein of unknown function (DUF3531) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12049 [flax] [poplar] DUF3531 Protein of unknown function (DUF3531)
Representative CDS sequence Show only first row Show all	>Lus10012917 pacid=23158555 polypeptide=Lus10012917 locus=Lus10012917.g ID=Lus10012917.BGIv1.0 annot-version=v1.0 ATGGGCAGCTGTCTCGTTGACCCTGAAAAGGCTCAGTCAAAGATGGAGGAGAGAATGAGGAGGAAAAGGAACAAGATTCTTCATAATAAGACCGGTTCGT CAACGCCGATGAAAACACTTCGGTCATGGCACATCATCGGGCGTCTAGGTGGATTCAACTCCATGAATATGCAGCTGTCACAATCAGGGTTGGGATCAAG CAATTGGGTTTTGGTGGGTCTGAATTAG
AA sequence Show only first row Show all	>Lus10012917 pacid=23158555 polypeptide=Lus10012917 locus=Lus10012917.g ID=Lus10012917.BGIv1.0 annot-version=v1.0 MGSCLVDPEKAQSKMEERMRRKRNKILHNKTGSSTPMKTLRSWHIIGRLGGFNSMNMQLSQSGLGSSNWVLVGLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29400			Protein of unknown function (D...		Lus10012917 [exp]	0	1
AT5G67530		ATPUB49	plant U-box 49 (.1)		Lus10007794 [exp]	6.7	0.7781
					Lus10012138 [exp]	27.9	0.6711
AT2G30530			unknown protein		Lus10034444 [exp]	30.3	0.7003
AT5G27410			D-aminoacid aminotransferase-l...		Lus10035342 [exp]	34.9	0.7133
AT1G27170			transmembrane receptors;ATP bi...		Lus10015453 [exp]	36.3	0.7018
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10018077 [exp]	37.5	0.6707
AT3G04670	WRKY	ATWRKY39, WRKY3...	WRKY DNA-binding protein 39 (....		Lus10014745 [exp]	38.6	0.7250
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10017541 [exp]	39.2	0.7000
AT1G13120		EMB1745	embryo defective 1745 (.1)		Lus10006979 [exp]	40.1	0.7113
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10028781 [exp]	52.9	0.6865

Compare expression of checked genes

Lus10012917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.