Lus10012924 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19790 281 / 4e-99 SNARE-like superfamily protein (.1)
AT1G47830 130 / 2e-39 SNARE-like superfamily protein (.1)
AT2G17380 124 / 4e-37 AP19 associated protein 19 (.1)
AT4G35410 124 / 4e-37 Clathrin adaptor complex small chain family protein (.1.2)
AT3G50860 111 / 9e-32 Clathrin adaptor complex small chain family protein (.1)
AT4G08520 44 / 6e-06 SNARE-like superfamily protein (.1)
AT1G60970 43 / 1e-05 SNARE-like superfamily protein (.1)
AT3G09800 42 / 3e-05 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035004 276 / 1e-97 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10024337 126 / 4e-37 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10026316 122 / 6e-36 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10042352 119 / 1e-34 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10003641 106 / 9e-30 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10041742 87 / 4e-22 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 84 / 8e-21 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Lus10037624 47 / 4e-07 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 47 / 4e-07 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G149100 286 / 2e-101 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.005G238701 127 / 1e-38 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 127 / 2e-38 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.012G052000 124 / 3e-37 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.014G079000 123 / 2e-36 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.002G001800 119 / 7e-35 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.007G025400 104 / 4e-29 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 100 / 3e-27 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Potri.003G043200 42 / 2e-05 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Potri.001G352900 41 / 6e-05 AT1G60970 278 / 6e-97 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10012924 pacid=23158550 polypeptide=Lus10012924 locus=Lus10012924.g ID=Lus10012924.BGIv1.0 annot-version=v1.0
ATGGGAATCCGGTTCATATTGATGGTGAACAAGCAAGGCCAGACTCGTCTTGCTCAATACTATGAATGGCTCACTCTGGAAGAGCGTCGAGCCATCGAAG
GCGAAATCGTCCGCAAGTGCCTCGCCCGCAACGAACAACAGTGTTCCTTCGTTGAGCACCGGAATTACAAGATCGTCTACAGGAGATACGCATCGCTGTT
TTTCTTGGTTGGAGTTGGCAATGACGAGAATGAGCTTGCAATTTTGGAATTTATACATCTGTTAGTGGAAACCATGGACCGTCATTTTGGCAATGTGTGT
GAGCTAGACATCATGTTCCATTTAGAGAAAGCACATTTCATGCTGGAAGAGATGGTCATGAATGGTTGCATTGTTGAGACGAGCAAATCCAACATCCTCA
GCCCCATACAGTTGATGGAGAAAATGTCCTAG
AA sequence
>Lus10012924 pacid=23158550 polypeptide=Lus10012924 locus=Lus10012924.g ID=Lus10012924.BGIv1.0 annot-version=v1.0
MGIRFILMVNKQGQTRLAQYYEWLTLEERRAIEGEIVRKCLARNEQQCSFVEHRNYKIVYRRYASLFFLVGVGNDENELAILEFIHLLVETMDRHFGNVC
ELDIMFHLEKAHFMLEEMVMNGCIVETSKSNILSPIQLMEKMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19790 SNARE-like superfamily protein... Lus10012924 0 1
AT1G51650 ATP synthase epsilon chain, mi... Lus10035755 1.4 0.9088
AT4G34840 ATMTN2, ATMTAN2 ARABIDOPSIS METHYLTHIOADENOSIN... Lus10042387 1.7 0.9137
AT5G18110 NCBP novel cap-binding protein (.1) Lus10005704 4.0 0.9005
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10041194 4.6 0.9055
AT5G07960 unknown protein Lus10034695 5.5 0.8770
AT1G11240 unknown protein Lus10011247 5.5 0.8986
AT2G32980 unknown protein Lus10030015 7.1 0.8706
AT5G07960 unknown protein Lus10021623 8.4 0.8728
AT1G05205 unknown protein Lus10039669 9.5 0.8894
AT3G05545 RING/U-box superfamily protein... Lus10020655 12.0 0.8890

Lus10012924 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.