Lus10012935 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29340 204 / 3e-69 PRF4 profilin 4 (.1)
AT2G19770 193 / 8e-65 PRF5 profilin 5 (.1)
AT4G29350 174 / 4e-57 PRF2, PFN2, PRO2 profilin 2 (.1)
AT2G19760 163 / 6e-53 PRF1, PFN1 profilin 1 (.1)
AT5G56600 159 / 8e-51 PRF3, PFN3 profilin 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034989 231 / 8e-80 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10043041 227 / 3e-78 AT4G29340 239 / 9e-83 profilin 4 (.1)
Lus10011139 225 / 2e-77 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10037591 193 / 9e-65 AT2G19770 231 / 6e-80 profilin 5 (.1)
Lus10034988 192 / 2e-64 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10006846 191 / 5e-64 AT2G19770 229 / 5e-79 profilin 5 (.1)
Lus10012936 188 / 8e-63 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10011138 181 / 6e-60 AT2G19760 225 / 2e-77 profilin 1 (.1)
Lus10043040 180 / 2e-59 AT5G56600 223 / 1e-76 profilin 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190800 195 / 1e-65 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.003G047700 193 / 9e-65 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.018G057600 188 / 9e-63 AT4G29340 188 / 5e-63 profilin 4 (.1)
Potri.006G235200 187 / 1e-62 AT4G29340 216 / 1e-73 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10012935 pacid=23158553 polypeptide=Lus10012935 locus=Lus10012935.g ID=Lus10012935.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAGACATATGTGGACGAGCACTTGATGTGCGAAATCGAAGGTCAACAAGGTCAACATCTTCAATCTGCTGCCATCTTCGGCCATGATGGCA
ACGTCTGGGCTCAGAGCTCTGCATTTCCTCAGTTCACGGGAACAGAGATGAGTGACATAATGAAGGATTTTGATGAACCGGGACATCTTGCCCCTACTGG
ATTACACGTTGCTGGTGCCAAGTATATGGTTATTCAGGGTGAGCCTGGTGCTGTTATTCGCGGCAAAAAGGGTGCTGGAGGGATCACCATTAAAAAGACA
GGGCAGGCACTGGTTATTGGAATTTATGAAGAACCAGTGACTCCTGGGCAATGCAACATGGTTGTTGAAAGGTTGGGAGATTACCTCCTTGACCAAGGCA
TGTAG
AA sequence
>Lus10012935 pacid=23158553 polypeptide=Lus10012935 locus=Lus10012935.g ID=Lus10012935.BGIv1.0 annot-version=v1.0
MSWQTYVDEHLMCEIEGQQGQHLQSAAIFGHDGNVWAQSSAFPQFTGTEMSDIMKDFDEPGHLAPTGLHVAGAKYMVIQGEPGAVIRGKKGAGGITIKKT
GQALVIGIYEEPVTPGQCNMVVERLGDYLLDQGM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29340 PRF4 profilin 4 (.1) Lus10012935 0 1
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Lus10022021 1.4 1.0000
AT3G02100 UDP-Glycosyltransferase superf... Lus10003456 2.0 1.0000
AT4G16270 Peroxidase superfamily protein... Lus10017069 2.2 0.9711
AT2G04810 Protein of unknown function (D... Lus10020538 2.4 0.9979
AT3G09290 C2H2ZnF TAC1 telomerase activator1 (.1) Lus10021213 2.8 0.9963
AT3G44220 Late embryogenesis abundant (L... Lus10005214 3.5 0.9695
AT5G09360 LAC14 laccase 14 (.1) Lus10026812 3.7 0.9579
AT3G14470 NB-ARC domain-containing disea... Lus10032781 4.0 0.9417
AT5G59310 LTP4 lipid transfer protein 4 (.1) Lus10028003 4.5 0.9197
AT5G17540 HXXXD-type acyl-transferase fa... Lus10020333 4.7 0.9134

Lus10012935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.