Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04550 135 / 8e-39 unknown protein AT5G28500 118 / 1e-33 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022014 [exp] 142 / 4e-44 AT3G04550 129 / 5e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G044900 [exp] 130 / 6e-37 AT3G04550 421 / 6e-145 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012941 pacid=23158584 polypeptide=Lus10012941 locus=Lus10012941.g ID=Lus10012941.BGIv1.0 annot-version=v1.0 ATGCAGCCGTACCAGCCCATCCGGTCGCCGCAGTCCCCTCTCCCATTGCAATACCGCTCCCTAGACCCGACCGAGCGCCTCGAGATCCTAGCTAACCGCA ACGGCTTCTGGTACGAGTATGACCCTCTCATAACTTTCCTCATCCGCGACGACTTCTCCCTTTCCTCCATCAAGGAGTCCACTGGAATCTCTGGCGTCAA GCAGAACCGTCTCGTTATCGGCGCTCAAGTCCCCGAATCCCTAATTGAGTCCCAAACCGACCTTGCACTCATCTCCCACTTCGAAACATCGGGCGTCGAG CTCCTTTACGAGCTTCACCTCCTCAGCATATCCCAATGTGTCCCCGCCGCTCATTTCATCATCGAGAACAAGTTTGATTCTTGA
AA sequence Show only first row Show all	>Lus10012941 pacid=23158584 polypeptide=Lus10012941 locus=Lus10012941.g ID=Lus10012941.BGIv1.0 annot-version=v1.0 MQPYQPIRSPQSPLPLQYRSLDPTERLEILANRNGFWYEYDPLITFLIRDDFSLSSIKESTGISGVKQNRLVIGAQVPESLIESQTDLALISHFETSGVE LLYELHLLSISQCVPAAHFIIENKFDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04550			unknown protein		Lus10012941 [exp]	0	1
AT1G20580			Small nuclear ribonucleoprotei...		Lus10013227 [exp]	54.7	0.7421
AT3G45740			hydrolase family protein / HAD...		Lus10008416 [exp]	74.2	0.7092
AT5G01840	OFP	AtOFP1	ARABIDOPSIS THALIANA OVATE FAM...		Lus10042224 [exp]	81.5	0.7286
					Lus10006652 [exp]	95.6	0.7331
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10015489 [exp]	167.6	0.7087
AT5G48905		LCR12	low-molecular-weight cysteine-...		Lus10017233 [exp]	250.3	0.6938
AT5G03620			Subtilisin-like serine endopep...		Lus10035598 [exp]	255.0	0.6755

Compare expression of checked genes

Lus10012941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.