Lus10012945 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012945 pacid=23158556 polypeptide=Lus10012945 locus=Lus10012945.g ID=Lus10012945.BGIv1.0 annot-version=v1.0
ATGGCGCCTCAGCCGAAGAGACGAAGGATCAACCAGCCTCTCAAGGTTGAATCCGCTTCCGGGTCCAAGAATCCAAAAGACGAAGCAGCAATCAGAAGCG
GTTTGAAAGATGCGGAAACAGGGAGCAGTAGCAGTAACAAGAATGTGAGGTCAGTGGATCCGTGGATAGAACAGTCTAAGAATTTTGCAGTGGCTGAAGC
TCAGAAAGACGGATGCACTGGAAACTATAAAATCTTGGATTCCCCATTTGGGAACTTCCTTCTCCCCGTCGTCCCAACTCGTGCTGACTTGTGTCCCAAC
TCTTAG
AA sequence
>Lus10012945 pacid=23158556 polypeptide=Lus10012945 locus=Lus10012945.g ID=Lus10012945.BGIv1.0 annot-version=v1.0
MAPQPKRRRINQPLKVESASGSKNPKDEAAIRSGLKDAETGSSSSNKNVRSVDPWIEQSKNFAVAEAQKDGCTGNYKILDSPFGNFLLPVVPTRADLCPN
S

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012945 0 1
AT1G55340 Protein of unknown function (D... Lus10010312 1.4 0.8921
AT1G04610 YUC3 YUCCA 3 (.1) Lus10032609 4.7 0.8903
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10020809 5.5 0.8849
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Lus10030600 7.5 0.8843
AT5G19670 Exostosin family protein (.1) Lus10011121 9.5 0.8381
AT5G61970 signal recognition particle-re... Lus10040614 11.7 0.8277
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 11.8 0.8736
AT1G07570 APK1A Protein kinase superfamily pro... Lus10000954 12.7 0.8772
AT3G52230 unknown protein Lus10038643 13.7 0.8561
AT1G54730 Major facilitator superfamily ... Lus10035354 16.0 0.8609

Lus10012945 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.