Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023536 [exp] 132 / 3e-41 ND / Lus10000178 [exp] 130 / 5e-39 ND / Lus10019772 [exp] 135 / 4e-38 AT5G50400 287 / 2e-84 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 27, purple acid phosphatase 27 (.1) Lus10040421 [exp] 104 / 2e-29 ND / Lus10013548 [exp] 107 / 4e-29 AT5G06600 55 / 3e-08 ubiquitin-specific protease 12 (.1.2.3) Lus10025569 [exp] 106 / 2e-28 AT5G06600 149 / 7e-39 ubiquitin-specific protease 12 (.1.2.3) Lus10017290 [exp] 102 / 1e-27 ND / Lus10029608 [exp] 97 / 3e-27 ND / Lus10017291 [exp] 100 / 7e-26 AT5G06600 100 / 3e-22 ubiquitin-specific protease 12 (.1.2.3)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012947 pacid=23158526 polypeptide=Lus10012947 locus=Lus10012947.g ID=Lus10012947.BGIv1.0 annot-version=v1.0 ATGGGCCAGATCACCAAGGATTTGGATGAGAGGTTGGCTTACAGGAAGGGGCAGCTGATATCTCTTGAGGCAGAGGTTTCTAGACTTGGGGAACAAGGCT CCATGCTGGAGACTGAAATTCAGCAATTCTCTTCCTGCAGAGCCAAAATTCTGGAACATGTAGATAATACTGCTGCCGAACTTGAGAAGGCAAACCAAGA GGCTTCCAGGGAACTTGATGAGCGAAAGAGATCATTCCCAGAGGAAGTAGGTGGAAAGCGGATGAGAGCCATGGAAAATCTGGCTCAGCCCAATGGAAGT TGGAAACTTTTCAAAAGTGTAGGATGGCAATAG
AA sequence Show only first row Show all	>Lus10012947 pacid=23158526 polypeptide=Lus10012947 locus=Lus10012947.g ID=Lus10012947.BGIv1.0 annot-version=v1.0 MGQITKDLDERLAYRKGQLISLEAEVSRLGEQGSMLETEIQQFSSCRAKILEHVDNTAAELEKANQEASRELDERKRSFPEEVGGKRMRAMENLAQPNGS WKLFKSVGWQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012947 [exp]	0	1
AT1G54730			Major facilitator superfamily ...		Lus10002258 [exp]	58.9	0.8142
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10008930 [exp]	67.3	0.8038
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017820 [exp]	68.0	0.7566
AT3G23360			Protein phosphatase 2C family ...		Lus10021171 [exp]	75.6	0.7989
AT3G45850			P-loop containing nucleoside t...		Lus10009073 [exp]	93.3	0.8036
AT5G42510			Disease resistance-responsive ...		Lus10038298 [exp]	150.0	0.7660
AT5G05390		LAC12	laccase 12 (.1)		Lus10009841 [exp]	159.2	0.7600
AT2G27550		ATC	centroradialis (.1)		Lus10043385 [exp]	169.0	0.7619
AT2G47460	MYB	PFG1, ATMYB12	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10002435 [exp]	195.3	0.7681
					Lus10000578 [exp]	260.0	0.7595

Compare expression of checked genes

Lus10012947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.