Lus10012948 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58360 62 / 6e-12 TRAF-like family protein (.1)
AT3G58250 61 / 3e-11 TRAF-like family protein (.1)
AT5G06600 61 / 4e-11 AtUBP12, UBP12 ubiquitin-specific protease 12 (.1.2.3)
AT2G05420 58 / 3e-10 TRAF-like family protein (.1)
AT3G11910 58 / 3e-10 AtUBP13, UBP13 ubiquitin-specific protease 13 (.1.2)
AT3G27040 56 / 2e-09 Meprin and TRAF (MATH) homology domain-containing protein (.1)
AT3G58270 55 / 3e-09 Arabidopsis phospholipase-like protein (PEARLI 4) with TRAF-like domain (.1), Arabidopsis phospholipase-like protein (PEARLI 4) with TRAF-like domain (.2)
AT3G58200 54 / 8e-09 TRAF-like family protein (.1)
AT3G58220 54 / 8e-09 TRAF-like family protein (.1.2)
AT3G58350 53 / 1e-08 RTM3 RESTRICTED TEV MOVEMENT 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008233 101 / 2e-25 ND /
Lus10013547 97 / 4e-25 AT3G44800 72 / 2e-14 Meprin and TRAF (MATH) homology domain-containing protein (.1)
Lus10013548 94 / 5e-23 AT5G06600 55 / 3e-08 ubiquitin-specific protease 12 (.1.2.3)
Lus10019772 90 / 4e-21 AT5G50400 287 / 2e-84 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 27, purple acid phosphatase 27 (.1)
Lus10017291 73 / 2e-15 AT5G06600 100 / 3e-22 ubiquitin-specific protease 12 (.1.2.3)
Lus10025569 71 / 2e-14 AT5G06600 149 / 7e-39 ubiquitin-specific protease 12 (.1.2.3)
Lus10027030 67 / 3e-13 AT5G06600 120 / 8e-30 ubiquitin-specific protease 12 (.1.2.3)
Lus10034129 66 / 3e-13 AT5G06600 164 / 2e-46 ubiquitin-specific protease 12 (.1.2.3)
Lus10043456 65 / 2e-12 AT5G06600 1925 / 0.0 ubiquitin-specific protease 12 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G012600 65 / 1e-12 AT5G06600 1909 / 0.0 ubiquitin-specific protease 12 (.1.2.3)
Potri.010G245100 64 / 4e-12 AT5G06600 1907 / 0.0 ubiquitin-specific protease 12 (.1.2.3)
Potri.006G198300 61 / 4e-11 AT5G06600 1954 / 0.0 ubiquitin-specific protease 12 (.1.2.3)
Potri.016G064100 61 / 4e-11 AT5G06600 1943 / 0.0 ubiquitin-specific protease 12 (.1.2.3)
Potri.003G103200 51 / 6e-08 AT3G17380 251 / 2e-82 TRAF-like family protein (.1)
Potri.001G130700 51 / 6e-08 AT3G17380 244 / 2e-79 TRAF-like family protein (.1)
Potri.008G005300 50 / 2e-07 AT3G17380 317 / 7e-108 TRAF-like family protein (.1)
Potri.010G075000 49 / 5e-07 AT1G04300 855 / 0.0 TRAF-like superfamily protein (.1.2.3.4)
Potri.008G163300 48 / 1e-06 AT1G04300 846 / 0.0 TRAF-like superfamily protein (.1.2.3.4)
Potri.017G049100 47 / 1e-06 AT3G17380 246 / 3e-80 TRAF-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0389 TRAF PF00917 MATH MATH domain
Representative CDS sequence
>Lus10012948 pacid=23158527 polypeptide=Lus10012948 locus=Lus10012948.g ID=Lus10012948.BGIv1.0 annot-version=v1.0
ATGGCGGATGAAGATGAGCATCAGGTCATGAGAAAGGATACCAAGAAATTCACATGGAGGATAGAGAATTTCTCAAAGTTGACGGAAACCAACGTTTATT
CTGACACTTTCTTAGTTGGGGGCCACAGATGGAGAATTGTTGCTTACCCAAAGGGGAATAAAGTAGCTGAACTAAAAGAACTTTCTACTAAAGGATTTCT
TGTTAATGATACCATCATGATTGAAGCTGAAGTTTCTCCAGAAGCTATAGCATCAGAAGCTGCTACAGATGAGGCTAAAGTAATCGAAGCCAATCCTGCT
GAGGCTAATGAAAATACAAACAGTTCCTTCTCTGCATCAAGTGTGCAATTTACAATTCGCAGCCTAGTCGCCGAACTTTCAGTAATGAGTACTATTGATG
GCAACACTTCTTCATCCGAAGGAAATGGGTTGACCTTGCTGCAACAGCTAAGGGACAAACTCGACATGTTCTTTGATATGTCACATGGGTTTCTATGTCA
AACCAAATCATCGATGTAG
AA sequence
>Lus10012948 pacid=23158527 polypeptide=Lus10012948 locus=Lus10012948.g ID=Lus10012948.BGIv1.0 annot-version=v1.0
MADEDEHQVMRKDTKKFTWRIENFSKLTETNVYSDTFLVGGHRWRIVAYPKGNKVAELKELSTKGFLVNDTIMIEAEVSPEAIASEAATDEAKVIEANPA
EANENTNSSFSASSVQFTIRSLVAELSVMSTIDGNTSSSEGNGLTLLQQLRDKLDMFFDMSHGFLCQTKSSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58360 TRAF-like family protein (.1) Lus10012948 0 1
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10017879 4.2 0.9453
AT1G16310 Cation efflux family protein (... Lus10001768 5.8 0.9506
AT1G80170 Pectin lyase-like superfamily ... Lus10026798 6.7 0.9239
AT2G36780 UDP-Glycosyltransferase superf... Lus10012011 8.1 0.9385
AT5G37990 S-adenosyl-L-methionine-depend... Lus10028500 10.4 0.9131
AT1G60790 TBL2 TRICHOME BIREFRINGENCE-LIKE 2,... Lus10030590 11.0 0.9314
AT4G04750 Major facilitator superfamily ... Lus10000924 12.2 0.9130
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10036075 12.6 0.8921
AT1G14180 RING/U-box superfamily protein... Lus10036764 12.6 0.9416
AT2G47460 MYB PFG1, ATMYB12 PRODUCTION OF FLAVONOL GLYCOSI... Lus10001458 13.0 0.9274

Lus10012948 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.