Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35190 498 / 6e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 456 / 4e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 380 / 9e-133 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 368 / 8e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 297 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 250 / 3e-82 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G50210 151 / 6e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 143 / 7e-40 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 140 / 9e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49620 136 / 4e-37 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034964 [exp] 677 / 0 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 523 / 0 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 503 / 4e-180 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 293 / 3e-98 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 225 / 7e-72 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 140 / 1e-38 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 116 / 2e-29 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004387 [exp] 112 / 4e-28 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10018836 [exp] 110 / 1e-27 AT5G51310 348 / 7e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086900 [exp] 597 / 0 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086800 [exp] 553 / 0 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G079600 [exp] 313 / 4e-106 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 144 / 2e-40 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.004G146000 [exp] 135 / 8e-37 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 134 / 6e-36 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 115 / 2e-29 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G201000 [exp] 114 / 8e-29 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150300 [exp] 113 / 2e-28 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G026700 [exp] 112 / 2e-28 AT4G21200 444 / 1e-157 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10012963 pacid=23158520 polypeptide=Lus10012963 locus=Lus10012963.g ID=Lus10012963.BGIv1.0 annot-version=v1.0 ATGGAGAAGATTCAAGAGCAGCAGCAGCACCAAGGAAACAATGTCTCTGTACTGAATTGCATCGATCTCTCCAGCACGGACCTCCAAAATTCCGTTTCCT TACTCAAACAGGCGTGCTTGGACTGTGGATTTTTCTACGTTGTGAATCACGGGATAAGCCGAGAATTCATGGCAGAGGTTTTTTCTCAGAGCAGGAACTT CTTCGAATTGCCAGGGAACGAGAAGATGAAGGTTCTGAGGAACGAGAAGCATCGAGGTTACACTCCGGAGCTGGACGAGCTTTTGGATCCTCAGAATCAA GTTCACGGAGACTATAAGGAGGGCTATTACATTGGAGTGGAGGTTCCTGAAGATGATCCTGACACAGATAAACCATTTTATGGGCCAAATGTTTGGCCAT CCTCAGACCTCTTACCGGGTTGGAGGGAAACCATGGAAAACTTTCATCAGCAAGCTTTAGATGTGGCAAGAAAGGTTGCAAGAATTATAGCTCTTGCGCT TGATCTAGAAGCTGATTTCTTTGATAAACCGGAGATGCTTGGCCATCCCATTGCAGTAATGCGGCTGCTGCACTATGGTGGTCAGGTTTCTGATCCCTCG AAGGGATTATATGGAGCTGGTGCCCATTCTGACTATGGTTTAATTACCCTCCTTGCTACCGATGACATCTACGGACTCCAAATATGCAAGGACAAGGATG CTCAACCTCAAGTATGGGAATATGTAGCTCCAGTGCAAGGAGCTTTCGTAGTAAATCTTGGTGACATGTTGGAACGCTGGAGCAACTGTATTTTCAAGTC CACATTACACAGGGTTCTAGGGAACGGGCAAGAGAGATATTCCATCGCATACTTCGTGGAACCAAGTCATGATTGTCTTGTCGAATGCTTGCCAACATGT AAATCAGAGGAAAATCCTCCGAAATTTCCAGCAATCAAATGCAGCACATACCTGACCCAACGCTACAAGGACACCCATGCGGATTTAAGCGTTTATGACC AGAAGCAGCATACCTGA
AA sequence Show only first row Show all	>Lus10012963 pacid=23158520 polypeptide=Lus10012963 locus=Lus10012963.g ID=Lus10012963.BGIv1.0 annot-version=v1.0 MEKIQEQQQHQGNNVSVLNCIDLSSTDLQNSVSLLKQACLDCGFFYVVNHGISREFMAEVFSQSRNFFELPGNEKMKVLRNEKHRGYTPELDELLDPQNQ VHGDYKEGYYIGVEVPEDDPDTDKPFYGPNVWPSSDLLPGWRETMENFHQQALDVARKVARIIALALDLEADFFDKPEMLGHPIAVMRLLHYGGQVSDPS KGLYGAGAHSDYGLITLLATDDIYGLQICKDKDAQPQVWEYVAPVQGAFVVNLGDMLERWSNCIFKSTLHRVLGNGQERYSIAYFVEPSHDCLVECLPTC KSEENPPKFPAIKCSTYLTQRYKDTHADLSVYDQKQHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Lus10012963 [exp]	0	1
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10000804 [exp]	4.5	0.7492
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10041227 [exp]	5.2	0.7423
AT2G34690		ACD11	ACCELERATED CELL DEATH 11, Gly...		Lus10023267 [exp]	5.8	0.7452
AT1G16010		AtMRS2-1, AtMGT...	magnesium transporter 2 (.1.2....		Lus10026063 [exp]	7.3	0.6864
AT3G05010			Protein of unknown function, t...		Lus10040523 [exp]	9.6	0.6834
AT4G30830			Protein of unknown function, D...		Lus10035817 [exp]	13.4	0.6570
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019446 [exp]	15.6	0.7379
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10026047 [exp]	17.9	0.7014
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019448 [exp]	19.9	0.7365
AT3G26670			Protein of unknown function (D...		Lus10012589 [exp]	21.4	0.7120

Compare expression of checked genes

Lus10012963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.