Lus10012972 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034949 113 / 4e-31 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012972 pacid=23158544 polypeptide=Lus10012972 locus=Lus10012972.g ID=Lus10012972.BGIv1.0 annot-version=v1.0
ATGCATTTCCCCACCGCCGCCCAAGCCGCCAGTACTACTACTTCCTCCGCCGCCGCTTCCGACGACGACGGTAACATCAGCAACTGCTCCAACGTCGGCG
CCTCCTCGACTTCTGCATGCTCCTCGTCGACAGAGGATCGTCATGACCCGTCCACGCCTTCCAGCGACAGCTCCAATACTGTCGCTGCTGCCGCTGCCGA
GGCAGAGGAGCTGTGCCAGATCGTTGAGCTCCCGAAACTGGGATCTGAAGAGTTTGTATTGTACGGAGACTCGTGGCTGTGTAATGATGATCAGACATGG
TACGCGGATTACGACGGCGTCGGAGTTGGAGGATACTACTTTAGCGACGAGACGAGGCATTTAGTGACGATGGGGGAAAGTAGCAGCAGCAACTGCGGCG
GCTTTGGAGCATTTTTGTGTGGCAATATTAGTTAG
AA sequence
>Lus10012972 pacid=23158544 polypeptide=Lus10012972 locus=Lus10012972.g ID=Lus10012972.BGIv1.0 annot-version=v1.0
MHFPTAAQAASTTTSSAAASDDDGNISNCSNVGASSTSACSSSTEDRHDPSTPSSDSSNTVAAAAAEAEELCQIVELPKLGSEEFVLYGDSWLCNDDQTW
YADYDGVGVGGYYFSDETRHLVTMGESSSSNCGGFGAFLCGNIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012972 0 1
AT4G10960 UGE5 UDP-D-glucose/UDP-D-galactose ... Lus10023074 1.7 0.9232
AT4G32800 AP2_ERF Integrase-type DNA-binding sup... Lus10034949 4.9 0.8944
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Lus10035235 7.1 0.8917
AT1G02460 Pectin lyase-like superfamily ... Lus10038059 9.2 0.9098
AT1G24430 HXXXD-type acyl-transferase fa... Lus10035932 16.2 0.9064
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Lus10032726 20.8 0.9030
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Lus10005780 23.9 0.8423
AT1G63940 MDAR6 monodehydroascorbate reductase... Lus10028763 24.2 0.9002
AT3G50280 HXXXD-type acyl-transferase fa... Lus10031149 24.2 0.8984
AT5G47770 FPS1 farnesyl diphosphate synthase ... Lus10006168 27.1 0.9010

Lus10012972 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.