Lus10012977 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19570 139 / 4e-43 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G084400 117 / 9e-35 AT5G19570 111 / 3e-32 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0184 DMT PF10639 TMEM234 Putative transmembrane family 234
Representative CDS sequence
>Lus10012977 pacid=23158583 polypeptide=Lus10012977 locus=Lus10012977.g ID=Lus10012977.BGIv1.0 annot-version=v1.0
ATGACCGGTGGCGTGGAGAAAATGGTAGCGGTTGGCCTAATCTGGGGCGCCACGAATGCTCTGATCCGTCGCGGGGCTCTGCTTTATGACAAGACATCTC
TAGGATCTCCCTCCCCCGCCGCCGTCGCACCAACCTCGATCCAAACGAAGCTCATCTCTTCCTTCAAAAGTTTAATCAGCCTGCTCTTGTTCTGGCAGTA
TTCCCTTCCTTTCTTGCTCAACCTCTCAGCCTCTGCTACTTTCTTCGCTCTACTAAGCGACGCCCCTATTTCCCTCGCCGTCCCCGTCACCAACGCCACC
ACTTTCGCCGTCACCGCCGTCTTTGGTATGCTGCTAGGTGAAGAAACTCGAATTGGTTTCGCATTGCTCGGCACTGCTTTTATTGTGGCTGGAATTTGGC
TTTGTATCACCTAG
AA sequence
>Lus10012977 pacid=23158583 polypeptide=Lus10012977 locus=Lus10012977.g ID=Lus10012977.BGIv1.0 annot-version=v1.0
MTGGVEKMVAVGLIWGATNALIRRGALLYDKTSLGSPSPAAVAPTSIQTKLISSFKSLISLLLFWQYSLPFLLNLSASATFFALLSDAPISLAVPVTNAT
TFAVTAVFGMLLGEETRIGFALLGTAFIVAGIWLCIT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19570 unknown protein Lus10012977 0 1
Lus10037253 2.2 0.8918
AT5G65270 AtRABA4a RAB GTPase homolog A4A (.1) Lus10000637 3.7 0.8852
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10039437 5.2 0.8784
AT1G13950 EIF5A, ATELF5A-... eukaryotic elongation factor 5... Lus10037129 5.7 0.8783
AT3G48590 CCAAT NF-YC1, ATHAP5A... "nuclear factor Y, subunit C1"... Lus10016750 9.9 0.8528
AT2G27260 Late embryogenesis abundant (L... Lus10043411 13.0 0.8511
AT4G03120 C2H2 and C2HC zinc fingers sup... Lus10011434 16.7 0.8608
AT4G29870 Oligosaccharyltransferase comp... Lus10035623 18.3 0.8766
AT1G51660 ATMKK4, ATMEK4 ARABIDOPSIS THALIANA MITOGEN-A... Lus10037339 20.2 0.8243
AT3G44610 Protein kinase superfamily pro... Lus10006272 20.7 0.8515

Lus10012977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.