Lus10012978 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28850 359 / 3e-125 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1)
AT4G25810 305 / 6e-104 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 302 / 4e-103 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57530 302 / 5e-103 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT3G23730 301 / 1e-102 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G57550 298 / 1e-101 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57540 295 / 4e-100 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT4G14130 295 / 4e-100 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G25820 289 / 9e-98 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT5G48070 286 / 1e-96 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011112 493 / 4e-178 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10043232 344 / 8e-119 AT4G28850 241 / 3e-78 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10010939 310 / 3e-106 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 309 / 9e-106 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 308 / 3e-105 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 308 / 4e-105 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 298 / 2e-101 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 298 / 4e-101 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 296 / 2e-100 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G084300 454 / 1e-162 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.006G160700 449 / 5e-161 AT4G28850 390 / 9e-138 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.002G060500 321 / 3e-110 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 320 / 6e-110 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095200 316 / 2e-108 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.002G060400 314 / 1e-107 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.013G005700 313 / 1e-106 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 311 / 1e-106 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170100 309 / 1e-105 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 309 / 1e-105 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10012978 pacid=23158582 polypeptide=Lus10012978 locus=Lus10012978.g ID=Lus10012978.BGIv1.0 annot-version=v1.0
ATGGCAACTTTTAGGTTCTCGCTTTTCATTGCATTGTCTGTATGTGCTGCTGTAGCATTCCACCAAACCTCCTCAGTTGATGCTAACTTCTACGAAACCG
TAGACTTCTATTGGGGCGAGCAACATTCGGCCATTTTTGGGAGTGGTGATGACCTCCAGTTGTTATTGGATAACACATCAGGCTCTGGGATTCAGTCGAA
GAGGGAATTCCTGTTTGGCAGCATTGAAATGTTAATCAAGTTGGTACCTGGAAACTCTGCAGGAACAGTCACTGCATATTATGTATCCTCCACCGGAGAC
AGGCACGACGAGATTGACTTTGAGTTCCTGGGAAATGTCTCGGGACAGCCATTCATCATCCACACTAACATCTACACTCAAGGAAATGGAAGCAGGGAAC
AGCAGTTCTACCCTTGGTTCGACCCAACTGCCGATTACCACAACTACACCATTCACTGGAATCCTTCTGCCATTGTGTGGTATGTGGACAGTGTGCCGAT
CAGGGTTTACCGCAACTACGAGAGTGAAGGGATCCCTTTCCCAAACAAACAAGGGATGCGAGCTTACTCCAGCTTATGGAATGCTGATAACTGGGCAACT
AGAGGAGGATTGGATAAGATCGACTGGACCTCCGCTCCCTTCATAGCTGGGTACCGCAACTTCGATGCACAGGCTTGCACGTGGAATGGTCTTTCCAGCA
TCGACCAATGTGCTCTCGATACCCCAGTTAATTGGTGGACATCTCCTGAGCACAAACAGCTGAGCTATGCTAAGCAAGGGCAGATGAAATGGGCAAGAGA
CAGTTACATGATCTATGACTACTGCACCGATTACCAGAGATTCAACGGCAACATGCCCCCTGAATGCTTCAAGCCACAATACTAA
AA sequence
>Lus10012978 pacid=23158582 polypeptide=Lus10012978 locus=Lus10012978.g ID=Lus10012978.BGIv1.0 annot-version=v1.0
MATFRFSLFIALSVCAAVAFHQTSSVDANFYETVDFYWGEQHSAIFGSGDDLQLLLDNTSGSGIQSKREFLFGSIEMLIKLVPGNSAGTVTAYYVSSTGD
RHDEIDFEFLGNVSGQPFIIHTNIYTQGNGSREQQFYPWFDPTADYHNYTIHWNPSAIVWYVDSVPIRVYRNYESEGIPFPNKQGMRAYSSLWNADNWAT
RGGLDKIDWTSAPFIAGYRNFDAQACTWNGLSSIDQCALDTPVNWWTSPEHKQLSYAKQGQMKWARDSYMIYDYCTDYQRFNGNMPPECFKPQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10012978 0 1
AT1G11770 FAD-binding Berberine family p... Lus10023366 1.4 0.9369
AT1G03170 FAF2 FANTASTIC FOUR 2, Protein of u... Lus10022036 2.8 0.8879
AT5G48540 receptor-like protein kinase-r... Lus10038227 3.2 0.9247
Lus10030114 4.2 0.8820
AT5G45340 CYP707A3 "cytochrome P450, family 707, ... Lus10028594 4.2 0.9051
AT1G28480 roxy19, GRX480 Thioredoxin superfamily protei... Lus10017693 4.5 0.8875
AT4G20860 FAD-binding Berberine family p... Lus10038446 7.7 0.8663
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10000453 9.5 0.8722
AT5G48490 Bifunctional inhibitor/lipid-t... Lus10016323 9.9 0.8589
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10002296 14.1 0.8704

Lus10012978 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.