Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012983 pacid=23158562 polypeptide=Lus10012983 locus=Lus10012983.g ID=Lus10012983.BGIv1.0 annot-version=v1.0 ATGCTAGTCATGGGAGGCTCGTTGTCGCCTAAGGTGACCTTCCAACGAGATTACTCCCCTCACAAGGATCACATGTCATGCGAAATCGGCAAAAAGTTGC GTATGTTTTGTCCATCGCTTCCTCCAGGATTTCCATTTGGTCGTAAGTCCGAAGACAGTGTTGTCGTGCTGACGAGCTGCTTCCTAGAGAAAGGTATGTA TGGCCGGTGCGTTGGGGGCATGGATCAACCAATGTTCCCCTCTCATGATTGA
AA sequence Show only first row Show all	>Lus10012983 pacid=23158562 polypeptide=Lus10012983 locus=Lus10012983.g ID=Lus10012983.BGIv1.0 annot-version=v1.0 MLVMGGSLSPKVTFQRDYSPHKDHMSCEIGKKLRMFCPSLPPGFPFGRKSEDSVVVLTSCFLEKGMYGRCVGGMDQPMFPSHD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012983 [exp]	0	1
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Lus10013794 [exp]	1.0	0.8920
AT3G56230			BTB/POZ domain-containing prot...		Lus10017414 [exp]	1.4	0.8210
AT1G14920	GRAS	RGA2, GAI	RESTORATION ON GROWTH ON AMMON...		Lus10036458 [exp]	2.0	0.7323
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Lus10020899 [exp]	7.1	0.7594
					Lus10002332 [exp]	13.6	0.7164
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	14.9	0.7164
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	16.1	0.7164
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	17.2	0.7164
AT2G23755			unknown protein		Lus10000575 [exp]	17.5	0.7097
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	18.2	0.7164

Compare expression of checked genes

Lus10012983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.