Lus10012985 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G42860 41 / 5e-05 zinc knuckle (CCHC-type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011688 47 / 2e-07 ND /
Lus10009212 46 / 2e-07 ND 37 / 0.001
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G112676 40 / 0.0001 AT5G13920 116 / 7e-28 GRF zinc finger / Zinc knuckle protein (.1)
Potri.T125604 40 / 0.0002 AT5G13920 115 / 1e-27 GRF zinc finger / Zinc knuckle protein (.1)
Potri.T125504 39 / 0.0002 AT5G13920 106 / 1e-25 GRF zinc finger / Zinc knuckle protein (.1)
Potri.009G094001 38 / 0.0005 AT3G42860 44 / 3e-05 zinc knuckle (CCHC-type) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF06839 zf-GRF GRF zinc finger
Representative CDS sequence
>Lus10012985 pacid=23158528 polypeptide=Lus10012985 locus=Lus10012985.g ID=Lus10012985.BGIv1.0 annot-version=v1.0
ATGACCAGTGTTGGATCTTCAGGCGGAACCTCCGAAGGCAGGAGTTCCTTCTATTCAGGCATAATCGGGCGTGCGCTATCAATACGTCAGGGACTCGAAA
AAAACCCAGGGAGGAAGTTCTACTGCTGCCCAGATTGGAGGGATCCGAAATCAAGTTGTGGGTTTTTCGGATGGGTTGATGTATGTCCGAAATTTGGCGA
CGAAGACGGTATCGATGTTATTGCAGCAGAGAACTGTCAACTGAAACCTAGATTGAAGGAGTTGTCCAATTCGATTATGATCGCTAGGTCGAAGGCCGAT
CGGAGGAAGAAAGGGACACCAATATTAATTACAGATTAA
AA sequence
>Lus10012985 pacid=23158528 polypeptide=Lus10012985 locus=Lus10012985.g ID=Lus10012985.BGIv1.0 annot-version=v1.0
MTSVGSSGGTSEGRSSFYSGIIGRALSIRQGLEKNPGRKFYCCPDWRDPKSSCGFFGWVDVCPKFGDEDGIDVIAAENCQLKPRLKELSNSIMIARSKAD
RRKKGTPILITD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G42860 zinc knuckle (CCHC-type) famil... Lus10012985 0 1
AT3G18290 BTS, EMB2454 embryo defective 2454, BRUTUS,... Lus10034346 1.0 0.9394
AT2G42920 Pentatricopeptide repeat (PPR-... Lus10007341 1.7 0.9228
AT2G27810 ATNAT12 ARABIDOPSIS NUCLEOBASE-ASCORBA... Lus10009402 2.0 0.9341
AT1G16560 Per1-like family protein (.1.2... Lus10038885 2.2 0.9118
AT2G33700 Protein phosphatase 2C family ... Lus10012244 2.6 0.9056
AT4G01030 pentatricopeptide (PPR) repeat... Lus10009813 4.0 0.9052
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032826 5.7 0.9130
AT5G61960 AML1 MEI2-like protein 1 (.1.2) Lus10032537 7.3 0.9043
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Lus10002473 8.5 0.9068
AT4G01030 pentatricopeptide (PPR) repeat... Lus10040917 9.2 0.8860

Lus10012985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.