Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53710 102 / 8e-27 AGD6 ARF-GAP domain 6 (.1.2) AT2G37550 100 / 4e-26 ASP1, AGD7 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) AT2G35210 41 / 5e-05 RPA, AGD10, MEE28 MATERNAL EFFECT EMBRYO ARREST 28, root and pollen arfgap (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023765 [exp] 108 / 9e-29 AT2G37550 507 / 4e-178 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10003978 [exp] 106 / 2e-28 AT2G37550 516 / 0.0 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10023766 [exp] 102 / 1e-26 AT2G37550 485 / 4e-170 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10038317 [exp] 81 / 2e-20 AT2G37550 166 / 5e-50 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10036211 [exp] 79 / 2e-20 AT2G37550 67 / 1e-14 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10029174 [exp] 0 / 1 AT3G53710 83 / 1e-18 ARF-GAP domain 6 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G095100 [exp] 104 / 2e-27 AT3G53710 462 / 9e-161 ARF-GAP domain 6 (.1.2) Potri.006G084000 [exp] 104 / 2e-27 AT3G53710 498 / 8e-175 ARF-GAP domain 6 (.1.2) Potri.001G142100 [exp] 47 / 5e-07 AT4G17890 535 / 0.0 ARF-GAP domain 8 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01412 [flax] [poplar] ArfGap Putative GTPase activating protein for Arf
Representative CDS sequence Show only first row Show all	>Lus10012991 pacid=23149800 polypeptide=Lus10012991 locus=Lus10012991.g ID=Lus10012991.BGIv1.0 annot-version=v1.0 ATGGCATCTTCTTGTGCTACGAAGTGCGGCAATAAGCACAAAGCTCTCGGCTTCCACAACTCCTCCCTCCGATCCCTCAACTTCATCAACCCTTGGTCGG AGATCGAGATCAAGCAGATGGAGATCGGTGACAACGAAACCCTCAACGCCTTCTTTTCAGAGCGAGGAATCCCTAAGGAGACCGATATCCTCCACAAGTA CCACACCAAAGCTGCCGCAGTTTACTGCGACCGGATCCAGGCCTTGGCTGAAGGGACGCCATGGCGTGATCAGAATAGCTGGGAAGATGATGTTGCGCTT ACATCTCCCGATGGCTCGATGATGCGGAGGAGAGAAGGATGA
AA sequence Show only first row Show all	>Lus10012991 pacid=23149800 polypeptide=Lus10012991 locus=Lus10012991.g ID=Lus10012991.BGIv1.0 annot-version=v1.0 MASSCATKCGNKHKALGFHNSSLRSLNFINPWSEIEIKQMEIGDNETLNAFFSERGIPKETDILHKYHTKAAAVYCDRIQALAEGTPWRDQNSWEDDVAL TSPDGSMMRRREG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	0	1
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	1.4	1.0000
					Lus10002332 [exp]	2.8	1.0000
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	3.5	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	4.0	1.0000
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	5.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	5.5	1.0000
					Lus10017627 [exp]	5.5	0.9171
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033189 [exp]	5.9	1.0000
					Lus10030331 [exp]	6.0	0.9864
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10033628 [exp]	6.3	1.0000

Compare expression of checked genes

Lus10012991 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.