Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24590 130 / 8e-38 RSZ22a, At-RSZ22a RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT4G31580 130 / 1e-37 SRZ22, RSZP22, SRZ-22, RSZ22, At-RSZ22 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) AT1G23860 128 / 3e-37 SRZ21, SRZ-21, RSZP21, RSZ21, At-RSZ21 RS-containing zinc finger protein 21 (.1.2.3.4) AT3G53500 48 / 2e-06 RSZ32, RS2Z32, At-RS2Z arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT1G02840 48 / 2e-06 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G02430 47 / 2e-06 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G37340 47 / 3e-06 RSZ33, ATRSZ33, RS2Z33, AT-RS2Z33 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) AT3G10400 43 / 7e-05 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT1G60650 42 / 0.0002 AtRZ-1b AtRZ-1b, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT3G49430 41 / 0.0004 SRP34A, SR34a, At-SR34a Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029171 [exp] 179 / 3e-54 AT4G31580 160 / 5e-47 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030858 [exp] 159 / 2e-47 AT4G31580 166 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030631 [exp] 154 / 3e-46 AT4G31580 164 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10026925 [exp] 139 / 2e-41 AT4G31580 184 / 2e-59 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10020123 [exp] 139 / 3e-41 AT4G31580 188 / 2e-61 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10015039 [exp] 48 / 2e-06 AT3G53500 256 / 8e-85 arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) Lus10003987 [exp] 48 / 3e-06 AT3G53500 255 / 2e-84 arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) Lus10008218 [exp] 45 / 2e-05 AT1G02840 228 / 3e-73 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10007869 [exp] 45 / 2e-05 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G050600 [exp] 149 / 3e-45 AT1G23860 131 / 3e-39 RS-containing zinc finger protein 21 (.1.2.3.4) Potri.006G272400 [exp] 141 / 7e-42 AT2G24590 152 / 4e-47 RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.018G009100 [exp] 136 / 6e-40 AT4G31580 174 / 2e-55 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Potri.010G227500 [exp] 49 / 1e-06 AT3G10400 223 / 7e-73 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.005G024600 [exp] 47 / 5e-06 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.006G215200 [exp] 46 / 7e-06 AT2G37340 266 / 6e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.016G081700 [exp] 46 / 9e-06 AT2G37340 268 / 2e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.014G129900 [exp] 45 / 1e-05 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.002G205025 [exp] 44 / 4e-05 AT1G02840 272 / 1e-90 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.013G015500 [exp] 44 / 5e-05 AT1G09140 263 / 7e-88 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0511 [flax] [poplar] Retroviral_zf PF00098 [flax] [poplar] zf-CCHC Zinc knuckle CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10012994 pacid=23149814 polypeptide=Lus10012994 locus=Lus10012994.g ID=Lus10012994.BGIv1.0 annot-version=v1.0 ATGTCGCGCGTGTACATTGGGAATCTGGACCCGCGAGTTAACGAGAGAGATCTGGAAGATGAGTTCCGTATGTATGGCGTTCTTCGCAGCGTCTGGGTTG CTCGAAGGCCGCCAGGTTATGCATTCATCGAGTTCGATGATCGCAGGGATGCTATAGACGCAATTCGCGCATTGGATGGGAAGAATGGATGGCGTGTGGA GCTTTCACACAATTCCAAGGATGGCGGAGGTGGAGGCCGAGGAGGGGGTGGACGTGGGAGGGGAGGAGGAGACGACTTGAAGTGCTACGAGTGTGGCGAA CCTGGTCATTTCGCTCGAGAATGCCGTGGAAAATTTGGTGGCTCGCGAGGTGGGGGTGGTCGCTATAGAAGTCCCAGCCCTCGACGTCGTAGGAGTCCTA GCTATGATAGATATGCCCGCAGGAATTACAGCCCTCACGGGAGGAAGTCTCCTCCTCTTCGACGTCGTAGCCCTTCTCCTCCTCGCCGTCCTCGAAGCTA TAGTAGGTCCCCTGTGCCTCAGTATCGCCATGCCCGCCGAGATTCGCCCTTTGCTAATGGGTATGCCAACCTGACTTGTTTGTCCATCTTGTCTAGTCCC CATACTCAATTTCTACCGCTGTTGACGGAAATGTGTTTGCTTGTTCAGCAGGGACTAGAGCTATGGAACGAGGCAATACTAAGGAGTCATGAGGAAGCAT TTGGCGTTGCACTATAG
AA sequence Show only first row Show all	>Lus10012994 pacid=23149814 polypeptide=Lus10012994 locus=Lus10012994.g ID=Lus10012994.BGIv1.0 annot-version=v1.0 MSRVYIGNLDPRVNERDLEDEFRMYGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRALDGKNGWRVELSHNSKDGGGGGRGGGGRGRGGGDDLKCYECGE PGHFARECRGKFGGSRGGGGRYRSPSPRRRRSPSYDRYARRNYSPHGRKSPPLRRRSPSPPRRPRSYSRSPVPQYRHARRDSPFANGYANLTCLSILSSP HTQFLPLLTEMCLLVQQGLELWNEAILRSHEEAFGVAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10012994 [exp]	0	1
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001017 [exp]	2.6	0.8711
AT5G52630		MEF1	mitochondrial RNAediting facto...		Lus10011323 [exp]	3.0	0.8398
AT1G34160			Tetratricopeptide repeat (TPR)...		Lus10029401 [exp]	4.7	0.8501
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10038396 [exp]	6.9	0.8274
AT5G64030			S-adenosyl-L-methionine-depend...		Lus10033481 [exp]	7.2	0.7304
AT4G34540			NmrA-like negative transcripti...		Lus10023558 [exp]	9.2	0.7558
AT3G23710		AtTic22-III	translocon at the inner envelo...		Lus10022378 [exp]	9.9	0.7971
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001015 [exp]	10.9	0.8119
AT3G55605			Mitochondrial glycoprotein fam...		Lus10030157 [exp]	11.8	0.8168
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Lus10032565 [exp]	14.8	0.7689

Compare expression of checked genes

Lus10012994 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.