Lus10013000 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10550 385 / 7e-135 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT2G01850 259 / 4e-85 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT1G14720 258 / 1e-84 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT1G32170 229 / 2e-73 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT4G18990 226 / 9e-72 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT3G44990 202 / 2e-63 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT2G36870 199 / 2e-62 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT5G65730 198 / 7e-62 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT5G13870 197 / 2e-61 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT3G25050 197 / 2e-61 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029165 549 / 0 AT1G10550 405 / 5e-143 xyloglucan:xyloglucosyl transferase 33 (.1)
Lus10029000 258 / 2e-84 AT1G14720 457 / 1e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10013240 252 / 4e-82 AT2G01850 456 / 2e-162 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Lus10030760 250 / 1e-81 AT1G14720 456 / 3e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10010427 229 / 5e-73 AT1G32170 462 / 5e-164 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Lus10026535 215 / 3e-68 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 213 / 2e-67 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 205 / 2e-64 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 205 / 2e-64 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G115000 403 / 5e-142 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.008G138400 260 / 1e-85 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.010G102300 259 / 5e-85 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.001G136100 240 / 2e-77 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.003G097300 238 / 8e-77 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.009G163850 230 / 2e-74 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.016G098600 205 / 2e-64 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G006600 203 / 7e-64 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.006G122900 201 / 3e-63 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.002G244200 198 / 7e-62 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10013000 pacid=23149860 polypeptide=Lus10013000 locus=Lus10013000.g ID=Lus10013000.BGIv1.0 annot-version=v1.0
ATGCTCTTCCCACTTCTGTATCTCCTGCTTCTTGCTGCAGCAGCATCAGGAGTTTCTTCACGTAACACCCCTTACACTCCTCCAAACGTCAAACGTTTGA
CTGATCTCTTTGGTCCCTTAACCATTAATCAAGGTTTCAACACTTACTATGGCGGCCAGCATGTTAAGCAGTTCAATAATGGGTCCTTTGCCACTCTTTC
CCTTGACAAAGCATCAGGAGCTGGGTTGGCATCTAAGAACAAATACTTATATGGGTTCTTCAGTGCTGCAATAAAGCTGCCTTCTGGTCTGTCTCCTGGA
GTTGTGGTAGCCTTCTATTTGTCTAATGCAGAAACTTACCCTCACAACCACGACGAGATTGATTTCGAAATACTCGGACACGACAGGAAGAACGACTGGA
ACTTGCAGACGAACGTGTACGCGAATGGGAGTGTGAACACTGGCAGGGAAGAGAAGTTCAACTTCTGGTTTGACCCTACTCAGGACTACCACAACTACAG
CATCATTTGGAACAGCCACCACATAGTGTTTCTGGTGGATAGTGTACCAGTGAGGGAGTACAAGTACAACCCAACAGCATACCCAATGAAACCAATGAGT
GTTATTGCAACAATATGGGATGGTTCAGAATGGGCAACAAATGGAGGGAAGTATCCAGTAAACTACAAGTATGCACCATTTGTGGTCTCAATTGGGGATG
CTGAATTGGCTGGCTGCATTCCATATCCAGCTTCTTCTGGTTCTTGCTCCAAGACTAGCAGTAGTACTAGTAGTCCTTCAAGCTTGGATCCAGTGGATGG
ATCAGAATTTGCTAGCTTGTCACAGGATCAGAGTTTGGCTATGGACTGGGCAAGGAGGAAGCTCATGTTCTACTCTTACTGTAGTGATAAACCTAGGTAC
AAGGTCCCACCACCTGAATGTAAATGA
AA sequence
>Lus10013000 pacid=23149860 polypeptide=Lus10013000 locus=Lus10013000.g ID=Lus10013000.BGIv1.0 annot-version=v1.0
MLFPLLYLLLLAAAASGVSSRNTPYTPPNVKRLTDLFGPLTINQGFNTYYGGQHVKQFNNGSFATLSLDKASGAGLASKNKYLYGFFSAAIKLPSGLSPG
VVVAFYLSNAETYPHNHDEIDFEILGHDRKNDWNLQTNVYANGSVNTGREEKFNFWFDPTQDYHNYSIIWNSHHIVFLVDSVPVREYKYNPTAYPMKPMS
VIATIWDGSEWATNGGKYPVNYKYAPFVVSIGDAELAGCIPYPASSGSCSKTSSSTSSPSSLDPVDGSEFASLSQDQSLAMDWARRKLMFYSYCSDKPRY
KVPPPECK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10550 XTH33, XET xyloglucan:xyloglucosyl transf... Lus10013000 0 1
AT4G10310 ATHKT1, HKT1 high-affinity K+ transporter 1... Lus10026948 1.7 0.8443
Lus10024338 2.0 0.8438
AT3G07470 Protein of unknown function, D... Lus10004300 2.4 0.7792
AT2G19770 PRF5 profilin 5 (.1) Lus10006846 3.5 0.7950
AT1G57680 unknown protein Lus10008924 4.5 0.7681
AT5G65470 O-fucosyltransferase family pr... Lus10002653 8.8 0.7644
AT5G01710 methyltransferases (.1) Lus10001267 9.2 0.7862
AT5G40150 Peroxidase superfamily protein... Lus10039471 15.1 0.7906
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10027195 15.9 0.7790
AT1G05710 bHLH bHLH153 basic helix-loop-helix (bHLH) ... Lus10027064 17.2 0.7780

Lus10013000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.