Lus10013026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23440 309 / 6e-108 Peptidase C15, pyroglutamyl peptidase I-like (.1.2)
AT1G56700 273 / 8e-94 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029137 446 / 5e-162 AT1G23440 311 / 8e-109 Peptidase C15, pyroglutamyl peptidase I-like (.1.2)
Lus10001521 257 / 5e-86 AT1G56700 312 / 2e-107 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Lus10031438 177 / 1e-52 AT1G09390 406 / 4e-139 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G005800 276 / 4e-95 AT1G56700 335 / 5e-118 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Potri.013G005100 274 / 4e-94 AT1G56700 344 / 1e-121 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0379 PgaPase PF01470 Peptidase_C15 Pyroglutamyl peptidase
Representative CDS sequence
>Lus10013026 pacid=23149817 polypeptide=Lus10013026 locus=Lus10013026.g ID=Lus10013026.BGIv1.0 annot-version=v1.0
ATGGGATCAGAAGCACCAAAGTCTGTAGTCGTCCACGTGACCGGATTCAAGAAATTCCAAGGTGTGACCCAGAATCCGACCGAGACTATAGTGAACAGGC
TCAAGGATTACGTCGCAAAGCGAGGATTGCTTGCTGGCGTTACGCTAGGCAGTTGCACTATCCTCGAAACGGCTGGAGATGGAGCTCTTACCATGCTCCA
CAACACTCTCGAATCAAACACCACCGCCACAATGAATGCAGAGAAGAACGAGCAAGTTGTCTGGCTTCACTTGGGGGTGAACAGCGGGGCAGTGAAGTTC
GCCATTGAACGATGTGCAGTTAATGAAGCCACTTTTCGATGCCCCGATGAGATGGGATGGCAACCTCAGAACCATCCTATAATCTCGGAAGATGGAGAAA
TTACTTGTCTAAGACAGACGTGGTGCCCGGTCGATGGTATCTTCATATACTTGAGGAAGAAAGGCTTCGATGCTACGATATCAGATGATGCTGGACGCTA
TGTCTGCAACTATGTATACTATCATTCGCTCAAGTTCGCCCAGCAGAAGGGCCACAAGTCTCTATTCGTTCATGTCCCGCTCTTCTCGAGAATCGACGAG
GAGACCCAGATGGAGTTTGTGGCGTCTGTTGTAGAAGCTATAGGATCCACCTGTTAA
AA sequence
>Lus10013026 pacid=23149817 polypeptide=Lus10013026 locus=Lus10013026.g ID=Lus10013026.BGIv1.0 annot-version=v1.0
MGSEAPKSVVVHVTGFKKFQGVTQNPTETIVNRLKDYVAKRGLLAGVTLGSCTILETAGDGALTMLHNTLESNTTATMNAEKNEQVVWLHLGVNSGAVKF
AIERCAVNEATFRCPDEMGWQPQNHPIISEDGEITCLRQTWCPVDGIFIYLRKKGFDATISDDAGRYVCNYVYYHSLKFAQQKGHKSLFVHVPLFSRIDE
ETQMEFVASVVEAIGSTC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23440 Peptidase C15, pyroglutamyl pe... Lus10013026 0 1
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10030810 1.4 0.9661
AT4G13830 J20 DNAJ-like 20 (.1.2) Lus10003149 1.7 0.9633
AT3G06810 IBR3 IBA-RESPONSE 3, acyl-CoA dehyd... Lus10020908 2.0 0.9648
AT5G43430 ETFBETA electron transfer flavoprotein... Lus10021198 2.8 0.9561
AT5G51970 GroES-like zinc-binding alcoho... Lus10031660 2.8 0.9627
AT2G14440 Leucine-rich repeat protein ki... Lus10041860 3.2 0.9620
AT4G37320 CYP81D5 "cytochrome P450, family 81, s... Lus10041643 3.2 0.9552
AT1G16390 3-Oct, ATOCT3 organic cation/carnitine trans... Lus10000286 3.9 0.9511
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10037268 4.2 0.9585
AT1G34320 Protein of unknown function (D... Lus10018317 4.6 0.9489

Lus10013026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.