Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23420 158 / 3e-48 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) AT1G08465 118 / 4e-33 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G45190 108 / 5e-29 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 102 / 2e-26 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2) AT2G26580 92 / 4e-23 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G69180 74 / 2e-16 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029135 [exp] 283 / 2e-97 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10030596 [exp] 182 / 3e-57 AT1G23420 194 / 8e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10032240 [exp] 120 / 3e-33 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 119 / 7e-33 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10019407 [exp] 108 / 7e-29 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10030892 [exp] 100 / 6e-27 AT1G23420 102 / 2e-28 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10010361 [exp] 88 / 7e-21 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10030893 [exp] 84 / 9e-21 AT1G23420 100 / 2e-27 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10036496 [exp] 80 / 3e-18 AT2G45190 183 / 2e-58 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G042400 [exp] 166 / 3e-51 AT1G23420 191 / 3e-61 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.008G189000 [exp] 150 / 2e-45 AT1G23420 213 / 7e-70 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.001G120200 [exp] 116 / 4e-32 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 115 / 1e-31 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 112 / 6e-31 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.006G067800 [exp] 112 / 8e-31 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.009G000100 [exp] 111 / 8e-31 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 106 / 2e-28 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 103 / 4e-27 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G214700 [exp] 96 / 2e-24 AT1G08465 183 / 8e-59 YABBY2, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10013028 pacid=23149816 polypeptide=Lus10013028 locus=Lus10013028.g ID=Lus10013028.BGIv1.0 annot-version=v1.0 ATGCCACTTAGCCATATGCTTGATCTTTCATCCTCAGCATCATCACTAGAGCAGATTTGCTATGTCCAGTGTGGTTTCTGCACCACAATCTTGCTGGTGA GTGTGCCATGCAGCAGCATGTCAATGGTGGTCACAGTTAGATGTGGCCACTGCACCAGTTTGCTCTCTGTCAACATGATGAAAGCCTCTTTCGTTCCCTT CCATCTCCTCGCCGCCTCCCTCGATCATTGCGGTCATGACATCGTCGCTCCTCCTCGGGACCATCCTCCTTGTCAGTCTTTACAAGATCAGAGTTTGAAC GAACGGCAAGAGGAGGTAGAAGAAGTGGCGAGTCCGGAAGAAGAAGAAGAAGAAGATCCCGAAGAAGGTGATCGGAAGGGAACACTGTCACGAATGAACA GTAGTACTTCTGATGACAACAATGAAGATCATGAAGATCCAACCACTAATCTCAACCGCACAATCAACAAACCTCCAGAGAAGAGACAGAGGGCTCCATC AGCATACAACTGCTTCATCAAGGAGGAAATCAAAAGGCTGAAATCTGAGAATCCAACCATGGCTCACAAGGAAGCTTTCAGCATGGCTGCAAAGAATTGG GCTCACTTCCCACCAGTCTATTACAGAGTAGAGGAAGATGGTATTGGTGATCAAATCAGGTTAACTAGATGA
AA sequence Show only first row Show all	>Lus10013028 pacid=23149816 polypeptide=Lus10013028 locus=Lus10013028.g ID=Lus10013028.BGIv1.0 annot-version=v1.0 MPLSHMLDLSSSASSLEQICYVQCGFCTTILLVSVPCSSMSMVVTVRCGHCTSLLSVNMMKASFVPFHLLAASLDHCGHDIVAPPRDHPPCQSLQDQSLN ERQEEVEEVASPEEEEEEDPEEGDRKGTLSRMNSSTSDDNNEDHEDPTTNLNRTINKPPEKRQRAPSAYNCFIKEEIKRLKSENPTMAHKEAFSMAAKNW AHFPPVYYRVEEDGIGDQIRLTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Lus10013028 [exp]	0	1
					Lus10011078 [exp]	3.3	1.0000
AT3G58150			Optic atrophy 3 protein (OPA3)...		Lus10039862 [exp]	4.6	1.0000
					Lus10011832 [exp]	5.3	1.0000
					Lus10022518 [exp]	5.7	1.0000
					Lus10039508 [exp]	6.9	1.0000
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10025763 [exp]	7.5	1.0000
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10017080 [exp]	8.4	1.0000
AT1G23340			Protein of Unknown Function (D...		Lus10019705 [exp]	8.9	1.0000
					Lus10043004 [exp]	10.8	1.0000
AT1G14000		VIK	VH1-interacting kinase (.1)		Lus10004066 [exp]	16.2	1.0000

Compare expression of checked genes

Lus10013028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.