Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48750 76 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G18280 74 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38170 62 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 59 / 7e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 57 / 4e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38195 57 / 4e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 56 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43666 56 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 55 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G57310 50 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029131 [exp] 100 / 7e-29 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033574 [exp] 61 / 3e-13 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017615 [exp] 60 / 4e-13 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017616 [exp] 59 / 1e-12 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033573 [exp] 56 / 3e-11 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G044500 [exp] 86 / 1e-23 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 86 / 2e-23 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.017G118700 [exp] 76 / 2e-19 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 70 / 4e-17 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10013030 pacid=23149818 polypeptide=Lus10013030 locus=Lus10013030.g ID=Lus10013030.BGIv1.0 annot-version=v1.0 ATGAGGAGATCGTTGGTAATGTTGAGTTTGGCAGTGGTGGCACTACTGTTGGCAGTGGCAGGTGGCGGGGCGAAGGCAGCCGTGACGTGTAGCCCGGTGC AGCTGAGCTCGTGCGCGTCGGCGATAAGCTCGTCAACGCCGCCTTCGAGTCAGTGCTGTAACAAGATCAGAGAGCAGAAGCCGTGCCTCTGCGGGTACTT GAAGAATCCGGCGCTCAGGGCGTACATCAACACCCCAAATGCCAGGAAGGTCGCCTCCACTTGTGGGACCCCCTTCCCCAACTGCTAA
AA sequence Show only first row Show all	>Lus10013030 pacid=23149818 polypeptide=Lus10013030 locus=Lus10013030.g ID=Lus10013030.BGIv1.0 annot-version=v1.0 MRRSLVMLSLAVVALLLAVAGGGAKAAVTCSPVQLSSCASAISSSTPPSSQCCNKIREQKPCLCGYLKNPALRAYINTPNARKVASTCGTPFPNC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10013030 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10029131 [exp]	1.0	0.9804
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Lus10007640 [exp]	2.4	0.9672
AT2G46890			Protein of unknown function (D...		Lus10010291 [exp]	2.8	0.9415
AT3G52790			peptidoglycan-binding LysM dom...		Lus10027407 [exp]	5.5	0.9462
AT1G08170			Histone superfamily protein (....		Lus10041351 [exp]	8.1	0.9363
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019029 [exp]	8.4	0.9330
AT3G47420		AtG3Pp1, ATPS3	Glycerol-3-phosphate permease ...		Lus10038923 [exp]	11.0	0.9064
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Lus10028888 [exp]	11.4	0.9149
AT1G62710		BETAVPE, BETA-V...	beta vacuolar processing enzym...		Lus10032236 [exp]	11.8	0.9409
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10029360 [exp]	14.3	0.8906

Compare expression of checked genes

Lus10013030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.