Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029127 [exp] 209 / 6e-71 AT1G23390 66 / 1e-12 Kelch repeat-containing F-box family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013034 pacid=23149847 polypeptide=Lus10013034 locus=Lus10013034.g ID=Lus10013034.BGIv1.0 annot-version=v1.0 ATGCAGTGCGGCGGAGAGATTGGTGAACTTCCGGGGGAGTATTTGAAACTTCTGGAGGTGGAATTCGGCAGCCTGTCGTCGGTGAACGCGAATTTCAAGG GTGATTTCGTGTTCGTGACGAACAATTCGGCACCAGAGTGGGTCGTCGTCGGGGAATTCGAGGACGGCGGACGGCGGATTACGTGGAGCAGCGTGAGCAA TCCGGTGGTGGACGATGGCGTGCGGGTTTCGAGCACGGTTGTGTACACGTGCGCCGACGTCGGTCTGGGGGATTTGCAGCAGGCTACGGTATCGGCGGGC TGGAGATTCTCGTTGAAAGACGGCGCGTAA
AA sequence Show only first row Show all	>Lus10013034 pacid=23149847 polypeptide=Lus10013034 locus=Lus10013034.g ID=Lus10013034.BGIv1.0 annot-version=v1.0 MQCGGEIGELPGEYLKLLEVEFGSLSSVNANFKGDFVFVTNNSAPEWVVVGEFEDGGRRITWSSVSNPVVDDGVRVSSTVVYTCADVGLGDLQQATVSAG WRFSLKDGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013034 [exp]	0	1
AT1G05060			unknown protein		Lus10035303 [exp]	1.0	0.9743
AT4G13940		MEE58, EMB1395,...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10043156 [exp]	6.9	0.9685
AT2G03200			Eukaryotic aspartyl protease f...		Lus10025702 [exp]	9.2	0.9652
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10008112 [exp]	9.7	0.9590
AT1G58070			unknown protein		Lus10019953 [exp]	10.0	0.9604
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Lus10028595 [exp]	10.7	0.9292
AT3G51710			D-mannose binding lectin prote...		Lus10025258 [exp]	14.7	0.9373
AT3G15040			Protein of unknown function, D...		Lus10034190 [exp]	14.8	0.9061
AT4G13010			Oxidoreductase, zinc-binding d...		Lus10025898 [exp]	15.2	0.9539
AT5G61750			RmlC-like cupins superfamily p...		Lus10022071 [exp]	16.4	0.9583

Compare expression of checked genes

Lus10013034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.