Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64750 48 / 3e-09 DSS1(I), ATDSS1(I), DSS1(I), ATDSS1(I), DSS1(I), ATDSS1(I), DSS1(I), ATDSS1(I), DSS1(I), ATDSS1(I), deletion of SUV3 suppressor 1(I) (.1), deletion of SUV3 suppressor 1(I) (.2), deletion of SUV3 suppressor 1(I) (.3) AT5G45010 47 / 7e-09 DSS1(V), ATDSS1(V), DSS1(V), ATDSS1(V), DSS1(V), ATDSS1(V), DSS1(V), ATDSS1(V), DSS1(V), ATDSS1(V), DSS1 homolog on chromosome V (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029113 [exp] 81 / 2e-19 AT1G68940 572 / 0.0 Armadillo/beta-catenin-like repeat family protein (.1.2.3) Lus10030906 [exp] 74 / 4e-19 AT1G64750 47 / 1e-08 deletion of SUV3 suppressor 1(I) (.1), deletion of SUV3 suppressor 1(I) (.2), deletion of SUV3 suppressor 1(I) (.3) Lus10030583 [exp] 74 / 4e-19 AT1G64750 47 / 9e-09 deletion of SUV3 suppressor 1(I) (.1), deletion of SUV3 suppressor 1(I) (.2), deletion of SUV3 suppressor 1(I) (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G066900 [exp] 63 / 7e-15 AT1G64750 50 / 7e-10 deletion of SUV3 suppressor 1(I) (.1), deletion of SUV3 suppressor 1(I) (.2), deletion of SUV3 suppressor 1(I) (.3) Potri.001G334600 [exp] 46 / 3e-08 AT1G64750 / deletion of SUV3 suppressor 1(I) (.1), deletion of SUV3 suppressor 1(I) (.2), deletion of SUV3 suppressor 1(I) (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05160 [flax] [poplar] DSS1_SEM1 DSS1/SEM1 family
Representative CDS sequence Show only first row Show all	>Lus10013049 pacid=23149804 polypeptide=Lus10013049 locus=Lus10013049.g ID=Lus10013049.BGIv1.0 annot-version=v1.0 ATGGCGACTGAGCAGAAACCAGCAACGGAGGACGTGAAGATGGACCTTTTCGAGGATGATGACGAGTTCGAGGAGTTCGGCATCAACCAAGAGTGGGACG ACAAGGTGGAAGCGAAAGAGGTGCCTCAGCAATGGGAAGATGACTGGGATGATGACGACGTCAACGACGATTTCTCTCTACAGCTGAAGAGGGAATTAGA GAACAACAAGTGA
AA sequence Show only first row Show all	>Lus10013049 pacid=23149804 polypeptide=Lus10013049 locus=Lus10013049.g ID=Lus10013049.BGIv1.0 annot-version=v1.0 MATEQKPATEDVKMDLFEDDDEFEEFGINQEWDDKVEAKEVPQQWEDDWDDDDVNDDFSLQLKRELENNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10013049 [exp]	0	1
AT5G16950			unknown protein		Lus10021093 [exp]	5.7	0.8721
AT5G26800			unknown protein		Lus10011180 [exp]	6.6	0.8732
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Lus10043147 [exp]	7.7	0.8293
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10034657 [exp]	8.0	0.8666
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Lus10013605 [exp]	10.0	0.8256
AT1G07170			PHF5-like protein (.1.2.3)		Lus10040654 [exp]	13.3	0.8382
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10017010 [exp]	14.3	0.8482
AT3G04780			Protein of unknown function (D...		Lus10020246 [exp]	15.3	0.8315
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10026383 [exp]	18.0	0.8715
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10029155 [exp]	18.3	0.8290

Compare expression of checked genes

Lus10013049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.