Lus10013062 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029097 239 / 4e-82 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G113800 57 / 8e-11 ND /
Potri.010G134800 56 / 2e-10 ND /
PFAM info
Representative CDS sequence
>Lus10013062 pacid=23149796 polypeptide=Lus10013062 locus=Lus10013062.g ID=Lus10013062.BGIv1.0 annot-version=v1.0
ATGTCTTCTCTCTTTGCAGTGTTCATCATTCCACATTTGTTCTCTTGCCTTTCTTCTCTAGCTACAAGGATGAATTCTTCTTCCCATGTTCTGGGAAGTT
CAAAGAATTTGAGTGGGACTAAAGCCATTGAGTCTGGATGGACAGACTATCTTGGCTCCTGGTGTTATGAAGATGAAGATTGCATGCATAAAAAGCAAGT
GAATCACAAGAATACTGGCTATGGCTATGGAAGTAATGAAGAAGAGGATGATGAAGGAGAGAGCGATGACTCAATGGTCTCAGATGCCTCATCTGGCCCA
AGTCATTCTGAACTTCCAAGCACCCAAAAGAAGGCTGTGTTTTGCTCATCAAGGAAAGACCATAAATTTGGGAAGCAAAGAGATGAAGCAAGGATCAAGG
TGGATAGAGAAGAGTGCATGGTATATGCAAAAAGTGCAGCTAGCCACAATGGATTGAAGGTCCAGAAAACCAAGAAGATGGAGCCTAAAACAGAGAAGGT
CTAA
AA sequence
>Lus10013062 pacid=23149796 polypeptide=Lus10013062 locus=Lus10013062.g ID=Lus10013062.BGIv1.0 annot-version=v1.0
MSSLFAVFIIPHLFSCLSSLATRMNSSSHVLGSSKNLSGTKAIESGWTDYLGSWCYEDEDCMHKKQVNHKNTGYGYGSNEEEDDEGESDDSMVSDASSGP
SHSELPSTQKKAVFCSSRKDHKFGKQRDEARIKVDREECMVYAKSAASHNGLKVQKTKKMEPKTEKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013062 0 1
Lus10029097 1.0 0.9464
AT3G11900 ANT1 aromatic and neutral transport... Lus10017224 6.9 0.8004
AT5G59320 LTP3 lipid transfer protein 3 (.1) Lus10025231 15.0 0.7922
AT3G52150 RNA-binding (RRM/RBD/RNP motif... Lus10041602 16.2 0.8516
AT3G56650 Mog1/PsbP/DUF1795-like photosy... Lus10042812 20.1 0.8464
Lus10040269 24.3 0.7847
AT5G25330 Core-2/I-branching beta-1,6-N-... Lus10002919 24.9 0.7972
AT1G47740 PPPDE putative thiol peptidase... Lus10003951 27.3 0.8020
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10016037 28.8 0.8229
AT4G30845 unknown protein Lus10026098 30.7 0.8240

Lus10013062 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.