Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40370 162 / 3e-53 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT5G63030 146 / 8e-47 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G20500 103 / 1e-29 Glutaredoxin family protein (.1) AT4G28730 102 / 1e-28 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT1G77370 97 / 4e-27 Glutaredoxin family protein (.1) AT2G20270 97 / 1e-26 Thioredoxin superfamily protein (.1.2) AT2G47870 79 / 2e-20 Thioredoxin superfamily protein (.1) AT4G15700 79 / 3e-20 Thioredoxin superfamily protein (.1) AT3G62950 78 / 5e-20 Thioredoxin superfamily protein (.1) AT4G15680 76 / 3e-19 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022253 [exp] 218 / 2e-75 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10042104 [exp] 147 / 5e-47 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10001237 [exp] 147 / 5e-47 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10017148 [exp] 108 / 1e-31 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10021590 [exp] 107 / 5e-31 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10022844 [exp] 100 / 9e-28 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10028355 [exp] 92 / 5e-25 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1) Lus10005938 [exp] 86 / 5e-23 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10040898 [exp] 85 / 8e-23 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G347700 [exp] 148 / 1e-47 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.012G082800 [exp] 134 / 5e-42 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.015G078900 [exp] 129 / 5e-40 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.018G133400 [exp] 104 / 5e-30 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.002G254100 [exp] 103 / 4e-29 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.007G017300 [exp] 95 / 2e-26 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.014G134200 [exp] 90 / 1e-24 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 89 / 3e-24 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 84 / 3e-22 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 84 / 4e-22 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10013089 pacid=23149310 polypeptide=Lus10013089 locus=Lus10013089.g ID=Lus10013089.BGIv1.0 annot-version=v1.0 ATGGCCATGTCTAAGGCTAAGGATCTCGTTTCCTCCAACGCCGTCGTTGTTTTCAGCAAGTCCTACTGTCCTTACTGTACGTCGGTGAAGAAGCTGTTTG ATCAGCTTGGAGCTGCTTACAAGGCCGTGGAGTTGGATAGAGAGAGTGATGGAGCTGATATCCAAGCAGCATTGGGGCAGTGGACAGGACAGAAGACAGT GCCTAATGTTTTCATTGGTGGCAAGCACATTGGTGGCTGCGACGATACAATTGCGCTGAACAAGGCAGGGAAGTTGGTTCCTCTTCTGACTGAAGCAGGA GCTATTGTTGCATCGTCTTCTTCCTAG
AA sequence Show only first row Show all	>Lus10013089 pacid=23149310 polypeptide=Lus10013089 locus=Lus10013089.g ID=Lus10013089.BGIv1.0 annot-version=v1.0 MAMSKAKDLVSSNAVVVFSKSYCPYCTSVKKLFDQLGAAYKAVELDRESDGADIQAALGQWTGQKTVPNVFIGGKHIGGCDDTIALNKAGKLVPLLTEAG AIVASSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Lus10013089 [exp]	0	1
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Lus10016586 [exp]	2.0	0.8477
AT2G01290		RPI2	ribose-5-phosphate isomerase 2...		Lus10036094 [exp]	4.2	0.8568
AT5G55640			unknown protein		Lus10043162 [exp]	5.5	0.7954
AT1G55805			BolA-like family protein (.1)		Lus10002318 [exp]	12.1	0.8057
AT4G01200			Calcium-dependent lipid-bindin...		Lus10008731 [exp]	12.4	0.8051
AT4G31560		HCF153	high chlorophyll fluorescence ...		Lus10039571 [exp]	13.2	0.8250
AT2G15910			CSL zinc finger domain-contain...		Lus10023841 [exp]	13.6	0.7831
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042468 [exp]	15.1	0.8238
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10035800 [exp]	15.4	0.7968
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	16.4	0.8036

Compare expression of checked genes

Lus10013089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.