Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64090 121 / 5e-35 RTNLB3 Reticulan like protein B3 (.1.2) AT2G46170 115 / 2e-33 Reticulon family protein (.1.2) AT5G41600 114 / 4e-32 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) AT4G23630 113 / 9e-32 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) AT4G11220 108 / 5e-30 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) AT3G61560 108 / 7e-30 Reticulon family protein (.1.2) AT3G10260 94 / 1e-24 Reticulon family protein (.1.2.3) AT3G18260 77 / 5e-18 Reticulon family protein (.1) AT4G01230 67 / 2e-14 Reticulon family protein (.1) AT1G68230 57 / 7e-11 Reticulon family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027548 [exp] 166 / 2e-52 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2) Lus10039307 [exp] 162 / 7e-51 AT1G64090 307 / 4e-106 Reticulan like protein B3 (.1.2) Lus10027546 [exp] 159 / 1e-49 AT4G11220 307 / 5e-106 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Lus10014948 [exp] 148 / 2e-45 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Lus10038833 [exp] 146 / 1e-44 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) Lus10028753 [exp] 118 / 7e-32 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3) Lus10036405 [exp] 110 / 1e-30 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2) Lus10041080 [exp] 110 / 1e-30 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2) Lus10020718 [exp] 96 / 5e-25 AT3G10260 325 / 2e-113 Reticulon family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G097700 [exp] 123 / 8e-36 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.015G027300 [exp] 122 / 3e-35 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.003G133600 [exp] 117 / 2e-33 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.012G035600 [exp] 117 / 2e-33 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.014G091200 [exp] 114 / 2e-32 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2) Potri.002G165400 [exp] 112 / 1e-31 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2) Potri.002G055600 [exp] 98 / 4e-26 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3) Potri.005G206800 [exp] 98 / 5e-26 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3) Potri.013G160900 [exp] 79 / 7e-19 AT4G11220 193 / 4e-61 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Potri.015G044300 [exp] 78 / 1e-18 AT3G18260 251 / 1e-84 Reticulon family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0484 [flax] [poplar] Peroxisome PF02453 [flax] [poplar] Reticulon Reticulon
Representative CDS sequence Show only first row Show all	>Lus10013099 pacid=23149302 polypeptide=Lus10013099 locus=Lus10013099.g ID=Lus10013099.BGIv1.0 annot-version=v1.0 ATGGCGGACAATGTCAGCCACCACGATTATCTGGTGGACAAGATCACCGAGAAGATCACCGGCCACCATGACGGATCCTCCGATTCTGACGACAAAAAGC CGTCCAAGGTCGATGCGTCAAATCCAAGTTACCGTCTCTTCGGCAGACACAAGCCCGTCCACAAGGTCTTCGGCGGCGGCAAACCTGCTGATGTTCTTCT GTGGAGGAACAAGAAAGTTCCAGGAGCAGTGGTTGGAGTTGCTACTGCAATCTGGATTCTGTTCGAATTGCTTGAATATCATCTGATCACCCTAGTTTTT CACTTGTCGATTCTTGCTCTGGCCATACTCTTACTTTGGTCCAACGCTTCCACCTTCATAAACAAGTCACCATCTTAG
AA sequence Show only first row Show all	>Lus10013099 pacid=23149302 polypeptide=Lus10013099 locus=Lus10013099.g ID=Lus10013099.BGIv1.0 annot-version=v1.0 MADNVSHHDYLVDKITEKITGHHDGSSDSDDKKPSKVDASNPSYRLFGRHKPVHKVFGGGKPADVLLWRNKKVPGAVVGVATAIWILFELLEYHLITLVF HLSILALAILLLWSNASTFINKSPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64090		RTNLB3	Reticulan like protein B3 (.1....		Lus10013099 [exp]	0	1
AT1G03390			HXXXD-type acyl-transferase fa...		Lus10017744 [exp]	8.3	0.7188
AT3G10460			Plant self-incompatibility pro...		Lus10016165 [exp]	12.2	0.6951
AT1G67950			RNA-binding (RRM/RBD/RNP motif...		Lus10034580 [exp]	12.5	0.7479
AT1G24460		TNO1	TGN-localized SYP41 interactin...		Lus10009250 [exp]	13.5	0.6945
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004602 [exp]	16.1	0.6219
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10028116 [exp]	16.9	0.7215
					Lus10020192 [exp]	35.8	0.6531
AT5G61340			unknown protein		Lus10003483 [exp]	37.1	0.6970
AT2G40080		ELF4	EARLY FLOWERING 4, Protein of ...		Lus10028288 [exp]	43.4	0.6723
AT5G25090		AtENODL13	early nodulin-like protein 13 ...		Lus10003432 [exp]	46.2	0.6682

Compare expression of checked genes

Lus10013099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.