Lus10013105 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028821 129 / 3e-37 AT3G01360 289 / 5e-97 Family of unknown function (DUF716) (.1), Family of unknown function (DUF716) (.2)
Lus10006584 49 / 2e-07 ND /
Lus10005027 48 / 3e-07 ND /
Lus10001855 41 / 2e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G122800 77 / 2e-17 AT3G01360 240 / 1e-77 Family of unknown function (DUF716) (.1), Family of unknown function (DUF716) (.2)
PFAM info
Representative CDS sequence
>Lus10013105 pacid=23149301 polypeptide=Lus10013105 locus=Lus10013105.g ID=Lus10013105.BGIv1.0 annot-version=v1.0
ATGTACGCAGCGGTTTGCATCTTCTCCTTCCTTTTCATCGCCGACTCTCTCGTTTCCCTATTCAACGCCGTTGACTCCGACGACGGTATCGGCTCCGCCC
TCCAGTTAAAGATTCTCTCCATCGCTGCCGTTTTCTTCTTCTACTCCGTCCTCGGTCTGGCCACGAGCCTCTCCTTAACCCCGATTCGTTTCCCTACGAA
GCTCCTCGATTTGATCCTCCTCTTCGGTTTCCTCGAAGAATCCTTGCTCTATTGCAGCGATTTACAGAGAAATAGAGGAATGAGGATTGCGATTTTGTAC
ACAGAGAGATGTTTCTTTTTTTTAAAAAAAATGCGGCGACACCGCCTTTTCCGACTCGGCGCCGCGGAGGCGCTCTCGGCGACAATTCGGCGACGATTCG
GCGACGATCAGTCCGCCTCGCACTAA
AA sequence
>Lus10013105 pacid=23149301 polypeptide=Lus10013105 locus=Lus10013105.g ID=Lus10013105.BGIv1.0 annot-version=v1.0
MYAAVCIFSFLFIADSLVSLFNAVDSDDGIGSALQLKILSIAAVFFFYSVLGLATSLSLTPIRFPTKLLDLILLFGFLEESLLYCSDLQRNRGMRIAILY
TERCFFFLKKMRRHRLFRLGAAEALSATIRRRFGDDQSASH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G01360 Family of unknown function (DU... Lus10013105 0 1
AT4G35130 Tetratricopeptide repeat (TPR)... Lus10003233 7.7 0.7818
AT2G27590 S-adenosyl-L-methionine-depend... Lus10020593 11.9 0.7251
AT4G22200 AKT3, AKT2/3 potassium transport 2/3 (.1) Lus10015474 25.0 0.7114
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10024690 31.2 0.6954
AT2G42920 Pentatricopeptide repeat (PPR-... Lus10020764 52.6 0.6991
Lus10010602 55.3 0.6091
AT1G42540 ATGLR3.3 glutamate receptor 3.3 (.1) Lus10016031 72.9 0.6825
AT3G56550 Pentatricopeptide repeat (PPR)... Lus10037387 75.2 0.6727
Lus10039498 84.9 0.6776
AT1G78840 F-box/RNI-like/FBD-like domain... Lus10008295 85.7 0.6655

Lus10013105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.