Lus10013106 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15090 184 / 2e-57 GroES-like zinc-binding alcohol dehydrogenase family protein (.1)
AT1G23740 57 / 4e-10 AOR alkenal/one oxidoreductase, Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
AT4G21580 45 / 6e-06 oxidoreductase, zinc-binding dehydrogenase family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003495 269 / 8e-91 AT3G15090 528 / 0.0 GroES-like zinc-binding alcohol dehydrogenase family protein (.1)
Lus10030873 65 / 1e-12 AT1G23740 519 / 0.0 alkenal/one oxidoreductase, Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Lus10030615 65 / 1e-12 AT1G23740 519 / 0.0 alkenal/one oxidoreductase, Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Lus10038206 46 / 3e-06 AT4G13010 451 / 3e-160 Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Lus10002346 45 / 4e-06 AT4G13010 265 / 3e-89 Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Lus10018450 45 / 9e-06 AT4G21580 503 / 0.0 oxidoreductase, zinc-binding dehydrogenase family protein (.1.2.3)
Lus10011233 45 / 9e-06 AT4G21580 502 / 1e-180 oxidoreductase, zinc-binding dehydrogenase family protein (.1.2.3)
Lus10003159 44 / 3e-05 AT4G13010 449 / 4e-158 Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Lus10025898 42 / 0.0001 AT4G13010 446 / 1e-158 Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G373200 200 / 6e-64 AT3G15090 515 / 0.0 GroES-like zinc-binding alcohol dehydrogenase family protein (.1)
Potri.016G136100 66 / 5e-13 AT1G23740 504 / 9e-180 alkenal/one oxidoreductase, Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Potri.008G161600 53 / 2e-08 AT1G23740 408 / 1e-142 alkenal/one oxidoreductase, Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Potri.001G140600 40 / 0.0003 AT5G61510 542 / 0.0 GroES-like zinc-binding alcohol dehydrogenase family protein (.1)
Potri.001G452600 40 / 0.0004 AT4G13010 469 / 1e-167 Oxidoreductase, zinc-binding dehydrogenase family protein (.1)
Potri.004G036100 39 / 0.0006 AT4G21580 525 / 0.0 oxidoreductase, zinc-binding dehydrogenase family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0296 GroES PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Representative CDS sequence
>Lus10013106 pacid=23149300 polypeptide=Lus10013106 locus=Lus10013106.g ID=Lus10013106.BGIv1.0 annot-version=v1.0
ATGCGACTTTTGAGCACTCGGTTCGGTTCAAGACACGGGGCTGCCACCCAATTCTTGAATTCGCGTTTGTGCAGGCACATTGTTACCAGCTGCAGGGCTG
TGATATTGCCACGGTTCGGTGGCCCAGAGGTGCTGGAGATCCGTGACAGTGTCGATTTGCCGCCGCTGAAATCCAATGAGGTCCTGGTTCGTGCTCTGGC
AGTTTCGGTCAATCCACTGGATACCAGAATGCGAGCAGGTTATGGTCGTTCAGTATTTGAACCACTTCTTCCACTGATCTTGGGTCGAGATGTTAGTGGT
GAAGTTGCCGCTGTTGGATCATCAGTCCGGTCACTAAGTGTGGGCCAAGAAGTTTTTGGTGCTCTGCATCCAACTGCAGTCAGGGGTACTTACACGGACT
ACGCTGTGCTTTCAGAAGAAGAACTTGCTGAAAAACCAGCATCTCTTACACATGTGGTATGTGCTGCGGTTTTTAGATTCCAGTTTGCAATTATGTGGTA
A
AA sequence
>Lus10013106 pacid=23149300 polypeptide=Lus10013106 locus=Lus10013106.g ID=Lus10013106.BGIv1.0 annot-version=v1.0
MRLLSTRFGSRHGAATQFLNSRLCRHIVTSCRAVILPRFGGPEVLEIRDSVDLPPLKSNEVLVRALAVSVNPLDTRMRAGYGRSVFEPLLPLILGRDVSG
EVAAVGSSVRSLSVGQEVFGALHPTAVRGTYTDYAVLSEEELAEKPASLTHVVCAAVFRFQFAIMW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15090 GroES-like zinc-binding alcoho... Lus10013106 0 1
AT2G25290 Phox1 Phox1, Octicosapeptide/Phox/Be... Lus10006196 5.5 0.7981
AT1G04910 O-fucosyltransferase family pr... Lus10017105 6.9 0.8163
AT4G00370 PHT4;4, ANTR2 anion transporter 2, Major fac... Lus10014769 7.1 0.8476
AT2G30160 Mitochondrial substrate carrie... Lus10042258 8.7 0.8225
AT1G58025 DNA-binding bromodomain-contai... Lus10035797 8.7 0.7304
AT1G51590 MNS1, MANIB ALPHA-MANNOSIDASE IB, alpha-ma... Lus10035727 10.5 0.7838
AT2G40860 protein kinase family protein ... Lus10002993 11.8 0.7935
AT3G05675 BTB/POZ domain-containing prot... Lus10033220 15.5 0.8077
AT5G40880 WD-40 repeat family protein / ... Lus10014612 19.8 0.7808
AT5G07370 ATIPK2A, IPK2a inositol polyphosphate kinase ... Lus10009397 21.2 0.7733

Lus10013106 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.