Plant FIBer expression Database

Lus10013113 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32470 140 / 2e-44 Cytochrome bd ubiquinol oxidase, 14kDa subunit (.1.2)
AT5G25450 138 / 1e-43 Cytochrome bd ubiquinol oxidase, 14kDa subunit (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008081
[exp]
184 / 3e-61 AT5G25450 195 / 1e-65 Cytochrome bd ubiquinol oxidase, 14kDa subunit (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G031400
[exp]
152 / 6e-49 AT5G25450 173 / 2e-57 Cytochrome bd ubiquinol oxidase, 14kDa subunit (.1.2)
Potri.006G250000
[exp]
151 / 1e-48 AT5G25450 172 / 7e-57 Cytochrome bd ubiquinol oxidase, 14kDa subunit (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02271 UCR_14kD Ubiquinol-cytochrome C reductase complex 14kD subunit
Representative CDS sequence
>Lus10013113 pacid=23164147 polypeptide=Lus10013113 locus=Lus10013113.g ID=Lus10013113.BGIv1.0 annot-version=v1.0
ATGTCGACCTTCTTGCAATCGTTTCTGGATCCAAGGAAGAACTGGTTCGCCAAGCAGCACATGAAAACCATCTCCGGCCGTCTCCGTAAATACGGTCTTA
GATACGACGATCTCTACGATCCCTACTTTGATTTGGATGTGAAGGAGGCGCTCAATCGGCTTCCTAGAGAGATCGTGGACGCTCGTAACCAGCGCCTCAA
ACGGGCCATGGATCTCTCCATGAAGCACGAGTACCTCTCTAAGGACCTCCAGGCAATGCAAACACCATTCAGGAGCTACCTCAAGGATATGCTGGCACTG
GTAAGTGATGTAGAGAAATTTGATTTACTGTCTTGA
AA sequence
>Lus10013113 pacid=23164147 polypeptide=Lus10013113 locus=Lus10013113.g ID=Lus10013113.BGIv1.0 annot-version=v1.0
MSTFLQSFLDPRKNWFAKQHMKTISGRLRKYGLRYDDLYDPYFDLDVKEALNRLPREIVDARNQRLKRAMDLSMKHEYLSKDLQAMQTPFRSYLKDMLAL
VSDVEKFDLLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10013113
[exp]
0 1
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10008081
[exp]
1.0 0.9601
AT1G72510 Protein of unknown function (D... Lus10013156
[exp]
1.4 0.9129
AT4G30960 CIPK6, SIP3, Sn... SNF1-RELATED PROTEIN KINASE 3.... Lus10021852
[exp]
2.0 0.8762
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10030871
[exp]
2.4 0.8831
AT1G13750 Purple acid phosphatases super... Lus10036904
[exp]
4.2 0.8579
AT4G22600 unknown protein Lus10028923
[exp]
6.3 0.8643
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Lus10004213
[exp]
6.5 0.8431
AT4G14380 unknown protein Lus10011818
[exp]
6.6 0.8448
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10025319
[exp]
7.7 0.8429
AT1G67570 Protein of unknown function (D... Lus10043011
[exp]
7.9 0.8490

Lus10013113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.