Lus10013118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 67 / 3e-15 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 61 / 1e-12 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019444 151 / 8e-48 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1)
Lus10033054 146 / 7e-46 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1)
Lus10030078 100 / 3e-27 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10017763 85 / 2e-22 ND 35 / 0.001
Lus10042435 74 / 2e-17 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10008085 65 / 1e-14 ND /
Lus10019978 63 / 3e-13 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026232 60 / 7e-12 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10020130 57 / 1e-10 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G031901 166 / 8e-54 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 164 / 3e-53 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.006G155000 145 / 2e-45 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G029100 101 / 2e-28 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 100 / 7e-28 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G098200 81 / 4e-20 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.003G218300 73 / 3e-17 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G176300 66 / 1e-14 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G179300 58 / 2e-11 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 57 / 5e-11 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10013118 pacid=23164144 polypeptide=Lus10013118 locus=Lus10013118.g ID=Lus10013118.BGIv1.0 annot-version=v1.0
ATGGCGCCGCCGACGACATCTATACGTTTCTTCACCTTCTTCTTGGCCGCCGCTGCCGTCGGATTCTTCCGACAATGCTCCGCCGACATAGGCACAGCTT
CCCACTACAGCGTCCCATACCTACCGACGGCGTGCTACGGAGGAGATAGGACGCAGTTCCCGACGAGCAACCTCTTCGCGGCGGCGGGAGAAGGAGTATG
GGACAACGGGGCGTCCTGTGGGCGGCAGTACATGGTGAGGTGCATCAGTGCGGTGGCTCCGAGAACCTGCATTCCCGGAGCCACCGTCAGGGTGAGGATC
GTCGACCGAGCTCAATCATCCGTCACTCGGCCGTCAAGAACAGGCACGACTTTGGTCCTGTCCACCTCCGCTTTTGCCGCCATTGCCAACGGTTCTCCCG
GCGCCATCAACATTGACTTTCAACAGTAA
AA sequence
>Lus10013118 pacid=23164144 polypeptide=Lus10013118 locus=Lus10013118.g ID=Lus10013118.BGIv1.0 annot-version=v1.0
MAPPTTSIRFFTFFLAAAAVGFFRQCSADIGTASHYSVPYLPTACYGGDRTQFPTSNLFAAAGEGVWDNGASCGRQYMVRCISAVAPRTCIPGATVRVRI
VDRAQSSVTRPSRTGTTLVLSTSAFAAIANGSPGAINIDFQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10013118 0 1
AT4G00910 Aluminium activated malate tra... Lus10001528 1.7 0.9382
AT4G00910 Aluminium activated malate tra... Lus10033223 2.8 0.8911
AT5G22290 NAC FSQ6, FAN, ANAC... fructose-sensing quantitative ... Lus10013316 4.2 0.8836
Lus10038978 4.6 0.9104
AT3G58060 Cation efflux family protein (... Lus10029300 5.7 0.8306
AT5G51070 SAG15, CLPD, ER... SENESCENCE ASSOCIATED GENE 15,... Lus10012953 5.9 0.8834
AT1G47710 Serine protease inhibitor (SER... Lus10019009 7.5 0.9134
AT4G10265 Wound-responsive family protei... Lus10031613 9.2 0.8899
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Lus10020550 21.2 0.8579
AT1G26380 FAD-binding Berberine family p... Lus10023374 22.1 0.7359

Lus10013118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.