Lus10013120 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11340 256 / 1e-88 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT5G16800 64 / 9e-13 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
AT3G02980 57 / 4e-10 MCC1 MEIOTIC CONTROL OF CROSSOVERS1 (.1)
AT5G13780 51 / 3e-08 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT2G38130 48 / 4e-07 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
AT1G03650 42 / 2e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008088 305 / 2e-107 AT5G11340 249 / 2e-85 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10013457 64 / 1e-12 AT5G16800 337 / 1e-117 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10041016 62 / 6e-12 AT5G16800 334 / 1e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10041514 51 / 4e-08 AT2G38130 287 / 3e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Lus10012579 49 / 2e-07 AT2G38130 286 / 7e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Lus10025567 45 / 5e-06 AT1G03650 233 / 8e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10021559 42 / 0.0001 AT2G06025 244 / 2e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G032400 281 / 1e-98 AT5G11340 270 / 4e-94 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.006G248900 277 / 4e-97 AT5G11340 280 / 3e-98 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.019G050700 70 / 7e-15 AT5G16800 334 / 2e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.013G079900 69 / 1e-14 AT5G16800 346 / 3e-121 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.001G432400 52 / 9e-09 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G429200 52 / 9e-09 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G435300 52 / 9e-09 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.011G139300 52 / 2e-08 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.009G056600 52 / 2e-08 AT5G13780 307 / 5e-108 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.013G134102 49 / 1e-07 AT1G03650 242 / 2e-83 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10013120 pacid=23164155 polypeptide=Lus10013120 locus=Lus10013120.g ID=Lus10013120.BGIv1.0 annot-version=v1.0
ATGGGGATTGATAGTAAGCAAGTCTCGATATCTTTGGATGGAGTGCGGGAGAAGAACATGATGCAGCTCAAGAAGCTCAACACCGTCCTCTTCCCCGTTC
GTTACAACGACAAGTACTACTCCGACGCCCTCGCTTCTTCCGACTTCACCAAACTCGCTTATTACAGCGACATCTGCGTCGGAGCCATTGCATGCCGCCT
GGAGAAGAAGGAAGGCGGGGCTGTCTGTGTTTACATCATGACTCTGGGCGTGCTAGCACCTTATCGCGAGTTAGGCATTGGGACGAGACTGTTGAACCAC
GTACTGGGTCTCTGCCAGAAGCAGAACAACATCCCCGAGATATACTTGCACGTGCAGACGAACAACAAAGATGCCATCAACTTCTACAAGAAGTTTGGGT
TCGAGATCACAGACACCATCCAGAATTACTACACCAACATTACGCCACCAGATTGCTACGTTGTTAAGAAATTCATTACTGAGACTGAGAAATGA
AA sequence
>Lus10013120 pacid=23164155 polypeptide=Lus10013120 locus=Lus10013120.g ID=Lus10013120.BGIv1.0 annot-version=v1.0
MGIDSKQVSISLDGVREKNMMQLKKLNTVLFPVRYNDKYYSDALASSDFTKLAYYSDICVGAIACRLEKKEGGAVCVYIMTLGVLAPYRELGIGTRLLNH
VLGLCQKQNNIPEIYLHVQTNNKDAINFYKKFGFEITDTIQNYYTNITPPDCYVVKKFITETEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11340 Acyl-CoA N-acyltransferases (N... Lus10013120 0 1
AT5G11340 Acyl-CoA N-acyltransferases (N... Lus10008088 1.0 0.8775
AT2G39170 unknown protein Lus10040608 3.5 0.8557
AT4G10955 alpha/beta-Hydrolases superfam... Lus10001819 4.2 0.8600
AT4G18975 Pentatricopeptide repeat (PPR)... Lus10028526 4.5 0.8715
AT4G01790 Ribosomal protein L7Ae/L30e/S1... Lus10007191 5.9 0.8317
AT3G61860 ATRSP31, At-RS3... arginine/serine-rich splicing ... Lus10005986 7.1 0.8122
AT1G64810 APO1 ACCUMULATION OF PHOTOSYSTEM ON... Lus10039122 11.3 0.8200
AT1G50670 OTU-like cysteine protease fam... Lus10021522 12.4 0.8045
AT1G75170 Sec14p-like phosphatidylinosit... Lus10025128 12.7 0.8164
AT2G35795 Chaperone DnaJ-domain superfam... Lus10015065 14.0 0.7439

Lus10013120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.