Plant FIBer expression Database

Lus10013122 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11330 87 / 9e-22 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008089
[exp]
153 / 7e-47 AT5G11330 483 / 1e-170 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G032500
[exp]
107 / 2e-29 AT5G11330 568 / 0.0 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Potri.006G248800
[exp]
98 / 5e-26 AT5G11330 427 / 4e-149 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
PFAM info
Representative CDS sequence
>Lus10013122 pacid=23164151 polypeptide=Lus10013122 locus=Lus10013122.g ID=Lus10013122.BGIv1.0 annot-version=v1.0
ATGTCAATTCTCGACACCGCAGTACTGGGGAAGTGCGTGGAGAAATGGGGCGTGGAGGGCTTGGCTTCAGCACTGGACGAGTATCAACGAGTTAGGGTGC
TGGTGACCTCCGAGCAAGTGCTGCATTCTCGGAGGATCGGGAGGATCAAGCAACGGCAGAGTTCCGAAGAGTGTGGAGAGGTTATTCGGCAGAGGAATAT
GCCATTCTTTCATGGTGCTCCTCTGTCTCTGGATTGA
AA sequence
>Lus10013122 pacid=23164151 polypeptide=Lus10013122 locus=Lus10013122.g ID=Lus10013122.BGIv1.0 annot-version=v1.0
MSILDTAVLGKCVEKWGVEGLASALDEYQRVRVLVTSEQVLHSRRIGRIKQRQSSEECGEVIRQRNMPFFHGAPLSLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11330 FAD/NAD(P)-binding oxidoreduct... Lus10013122
[exp]
0 1
AT5G11330 FAD/NAD(P)-binding oxidoreduct... Lus10013121
[exp]
1.4 0.9357
AT1G54730 Major facilitator superfamily ... Lus10029966
[exp]
1.4 0.9383
AT1G01750 ADF11 actin depolymerizing factor 11... Lus10008489
[exp]
3.5 0.9113
AT3G16230 Predicted eukaryotic LigT (.1.... Lus10006828
[exp]
7.9 0.9159
AT1G07570 APK1A Protein kinase superfamily pro... Lus10000954
[exp]
9.2 0.8996
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10023203
[exp]
9.5 0.9037
AT2G39000 Acyl-CoA N-acyltransferases (N... Lus10040401
[exp]
10.9 0.8984
AT1G54730 Major facilitator superfamily ... Lus10035354
[exp]
11.8 0.8904
AT2G45990 unknown protein Lus10036369
[exp]
12.4 0.8919
AT2G28060 5'-AMP-activated protein kinas... Lus10008427
[exp]
15.5 0.8925

Lus10013122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.