Lus10013127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25120 146 / 2e-44 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008094 303 / 5e-106 AT3G25120 191 / 5e-62 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G246000 199 / 5e-65 AT3G25120 173 / 4e-55 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10013127 pacid=23164174 polypeptide=Lus10013127 locus=Lus10013127.g ID=Lus10013127.BGIv1.0 annot-version=v1.0
ATGGCTTCAGGCGGTGATGCAAAGCCTCCGCGACGAGACGTCGGAGAACGGCGATCATCCGCGCCGCCTTCTCCTTCATTCTACGATGATTGGAAGAAGC
GTATAATACTCCCAACTATTCTTGCAGGAGCTTGCGGTGGAGGATTTGGGTTGTTGTCTAAGCATCGGAATGGGCAAGGACTTTCTGCCGTTTCTGCTGC
TTACACTGCTAATTTCGCCATTGTCACTGGCTGCTACTGCGGGGCAAGGGAATTCGTAAGAGTAACCCGTAAATCAGACTATGACGATCTGCTAAACTCT
GCCATTGCTGGGTTCAGTACTGGTGCTCTCCTCGGCCGTTTCCAAGCGGGTCAGATGGGCGCAATCAGGTACTCGATCATGTTCAGCATCGCAGGTACTG
CAGTAGATTACGCTACAATCAAGCTGAGACCGAGATTAAGGGGCTGGAAAGAGTCGATATTCGGGGACGAAAACAACAACGGATGGAAGTTGCCGGTATG
GTCGCCGATACAAGTGCTTGACGAGGAGGCTATGGCTAAGAAAGAAGCTCAAGAGAAGGAATTTAATGCACAAAGAGCAGCGATTCTTAAGCTGACAAAA
GAAGAGTCGTGA
AA sequence
>Lus10013127 pacid=23164174 polypeptide=Lus10013127 locus=Lus10013127.g ID=Lus10013127.BGIv1.0 annot-version=v1.0
MASGGDAKPPRRDVGERRSSAPPSPSFYDDWKKRIILPTILAGACGGGFGLLSKHRNGQGLSAVSAAYTANFAIVTGCYCGAREFVRVTRKSDYDDLLNS
AIAGFSTGALLGRFQAGQMGAIRYSIMFSIAGTAVDYATIKLRPRLRGWKESIFGDENNNGWKLPVWSPIQVLDEEAMAKKEAQEKEFNAQRAAILKLTK
EES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25120 Mitochondrial import inner mem... Lus10013127 0 1
AT1G24050 RNA-processing, Lsm domain (.1... Lus10010705 2.6 0.8958
AT1G05205 unknown protein Lus10039669 7.7 0.8833
AT5G16870 Peptidyl-tRNA hydrolase II (PT... Lus10009246 8.1 0.8950
AT5G20570 HRT1, ROC1, RBX... REGULATOR OF CULLINS-1, RING-b... Lus10015667 9.5 0.8894
AT3G03100 NADH:ubiquinone oxidoreductase... Lus10030358 10.6 0.8722
AT1G19860 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10024316 11.2 0.8517
AT1G56440 TPR5 tetratricopeptide repeat 5, Te... Lus10010915 14.5 0.8591
AT3G58680 MBF1B, ATMBF1B multiprotein bridging factor 1... Lus10013686 15.7 0.8728
Lus10022462 17.7 0.8612
AT3G04780 Protein of unknown function (D... Lus10020246 18.7 0.8427

Lus10013127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.