Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61700 128 / 2e-40 RNA polymerases N / 8 kDa subunit (.1) AT1G11475 125 / 4e-39 NRPE10, NRPD10, NRPB10 RNA polymerases N / 8 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008095 [exp] 135 / 6e-43 AT1G61700 132 / 5e-42 RNA polymerases N / 8 kDa subunit (.1) Lus10025907 [exp] 108 / 1e-32 AT1G61700 105 / 5e-32 RNA polymerases N / 8 kDa subunit (.1) Lus10038195 [exp] 108 / 2e-32 AT1G61700 105 / 6e-32 RNA polymerases N / 8 kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G102900 [exp] 131 / 1e-41 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1) Potri.006G136300 [exp] 131 / 1e-41 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01194 [flax] [poplar] RNA_pol_N RNA polymerases N / 8 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10013128 pacid=23164179 polypeptide=Lus10013128 locus=Lus10013128.g ID=Lus10013128.BGIv1.0 annot-version=v1.0 ATGATTATACCAGTTCGTTGCTTCACTTGCGGCAAGGTGATTGGCCACAAGTGGGATACTTACCTTGATCTACTTCAGGCTGATTACACTGAAGGTGATG CTCTTGATGCACTGGGGTTGGTTCGTTATTGTTGCAGAAGAATGCTCATGACCCATGTCGATCTCATCGAAAAGCTCCTAAACTACAATACCTGCCATTT AACTTTGTTCTTGCTTAATCTCTGTTGCAGCTCTGGAGAAGAGCGAGGGCTCTTAATGGTAAAAAAAACTTGTCCTGGAGTCGGATTTAGGTACATAACC GGTTTCTGTAGAGAGCTGTAA
AA sequence Show only first row Show all	>Lus10013128 pacid=23164179 polypeptide=Lus10013128 locus=Lus10013128.g ID=Lus10013128.BGIv1.0 annot-version=v1.0 MIIPVRCFTCGKVIGHKWDTYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNTCHLTLFLLNLCCSSGEERGLLMVKKTCPGVGFRYIT GFCREL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10013128 [exp]	0	1
AT4G10270			Wound-responsive family protei...		Lus10033729 [exp]	11.7	0.7314
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	13.4	0.7739
AT3G18420			Protein prenylyltransferase su...		Lus10035087 [exp]	13.8	0.7586
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	14.8	0.7377
					Lus10025936 [exp]	19.3	0.7284
AT4G09820	bHLH	BHLH42, TT8, bH...	TRANSPARENT TESTA 8, basic hel...		Lus10022032 [exp]	20.3	0.7143
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10001652 [exp]	27.4	0.7289
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10013799 [exp]	28.7	0.7501
AT4G25315			Expressed protein (.1.2)		Lus10014065 [exp]	28.8	0.6809
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10036465 [exp]	33.2	0.7327

Compare expression of checked genes

Lus10013128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.