Lus10013132 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52800 196 / 6e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52820 195 / 2e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 184 / 4e-56 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 175 / 1e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 153 / 4e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 138 / 1e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 136 / 9e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 129 / 4e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G19010 114 / 5e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT3G21420 105 / 1e-25 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008097 565 / 0 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016659 199 / 1e-61 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 186 / 7e-57 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013130 172 / 3e-51 AT1G52820 200 / 3e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005516 158 / 2e-45 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023160 141 / 2e-40 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005776 140 / 4e-39 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773 137 / 5e-38 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021025 129 / 6e-35 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G033400 352 / 9e-122 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 351 / 1e-120 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176200 214 / 1e-67 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000 186 / 7e-57 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 182 / 2e-55 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 181 / 7e-55 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 166 / 5e-49 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176500 165 / 1e-48 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.004G146100 119 / 6e-31 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G146000 112 / 4e-28 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10013132 pacid=23164177 polypeptide=Lus10013132 locus=Lus10013132.g ID=Lus10013132.BGIv1.0 annot-version=v1.0
ATGGTGGATATCCCACTCATCAACCTGGCCGGAATCGCCGCCGTAACCGAGTGGCGGGAACTTTGCGACAAGGTAAGGGAGGCGTGCGAGACCCACGGCT
GTTTCTGCATCAAGACTGACGAGATCTCCGGCGAGATGAGGGACAGGATGGTAAAAGCGCTGAGTCAACTCTTCGACTTGCCGGAGGAGACCAAGAAGCT
CCACGTCCACCCCAAGCCTTACCGGAGCTACCTCGGAAAAAACGACGTCGTCCCTTACCTCGAGAGCTTCGGCATCGATCATTCCCCTCAGCATGATGAA
ACTAAAGCCTTTTCTCAACTCATGTGGCCAGATGGAAACCCTTCTTTCAATGAAGCACTGAACGAGATGAGTACAAAGATGCTGGAGCTGAACCTCTTGC
TGATGAAGATGATCTTCACCAGCTTCGGACTCCACAGCCAGCTGTACGAGACCTACGCGGCGGAGAGCATCAGCAACCTCCGCCTCATGAAGTACAAGGT
CCCACCACCCACCACCGCTGCCCCAGCTCCCAGCCTGGTGGCCCACACTGACAAGAACGCTCTGACCATCCTAGGCCAGAACGATGTCCAGGGTCTGGAG
ATCCAGACCAAAGATGACGGACAGTGGGTCCAGGTCGTGATCCCCGAAGGCGCGGTCATCGCCATCGTGGGTGACGCGCTCAAGGCGTGGAGCAACGGGA
GGCTCCACGCTGTGAGGCACAGGGTGGTGACTAGAAGTGACAAGGAGAGGTACTCGTGGGGGATGTTTATGATGCCGAATGATTGTGTCACGATCGAGGT
GGCCAAGGAGTTGGTGGACAAGGAGCATCCTTTGTTGTATCGGCCCTTTAACTATGCCGAGTTTCTGGCCTATTACATCGGTAAGTTGGGCGACGATGCT
CTCGAGATTTATGCCGGTGTCCCGCCCATCGCGATTGCGTAG
AA sequence
>Lus10013132 pacid=23164177 polypeptide=Lus10013132 locus=Lus10013132.g ID=Lus10013132.BGIv1.0 annot-version=v1.0
MVDIPLINLAGIAAVTEWRELCDKVREACETHGCFCIKTDEISGEMRDRMVKALSQLFDLPEETKKLHVHPKPYRSYLGKNDVVPYLESFGIDHSPQHDE
TKAFSQLMWPDGNPSFNEALNEMSTKMLELNLLLMKMIFTSFGLHSQLYETYAAESISNLRLMKYKVPPPTTAAPAPSLVAHTDKNALTILGQNDVQGLE
IQTKDDGQWVQVVIPEGAVIAIVGDALKAWSNGRLHAVRHRVVTRSDKERYSWGMFMMPNDCVTIEVAKELVDKEHPLLYRPFNYAEFLAYYIGKLGDDA
LEIYAGVPPIAIA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10013132 0 1
AT4G36380 ROT3 ROTUNDIFOLIA 3, Cytochrome P45... Lus10041794 1.0 0.9490
AT4G36380 ROT3 ROTUNDIFOLIA 3, Cytochrome P45... Lus10028345 2.4 0.8882
AT3G17810 PYD1 pyrimidine 1 (.1) Lus10041990 2.4 0.8944
AT4G19380 Long-chain fatty alcohol dehyd... Lus10035673 7.1 0.8882
AT1G75540 CO LHUS, AtBBX21, ... long hypocotyl under shade, B-... Lus10033184 7.3 0.8813
Lus10025501 7.3 0.9039
AT1G78850 D-mannose binding lectin prote... Lus10000579 7.4 0.8722
AT3G50150 Plant protein of unknown funct... Lus10010065 7.9 0.8854
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10040468 8.5 0.8919
AT2G41540 GPDHC1 6-phosphogluconate dehydrogena... Lus10031052 10.7 0.8414

Lus10013132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.