Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15550 97 / 5e-25 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) AT1G80330 93 / 2e-23 ATGA3OX4 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 4, gibberellin 3-oxidase 4 (.1) AT4G21690 92 / 6e-23 ATGA3OX3 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) AT1G80340 89 / 4e-22 ATGA3OX2, GA4H ARABIDOPSIS THALIANA GIBBERELLIN-3-OXIDASE 2, gibberellin 3-oxidase 2 (.1) AT4G10490 87 / 2e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 84 / 3e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G50960 84 / 6e-20 ATGA2OX7 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 7, gibberellin 2-oxidase 7 (.1) AT1G62380 82 / 2e-19 ATACO2, ACO2 ACC oxidase 2 (.1) AT5G43450 82 / 2e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G12010 82 / 3e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008100 [exp] 245 / 4e-82 AT4G21690 273 / 8e-90 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) Lus10013135 [exp] 204 / 2e-66 AT1G15550 263 / 4e-86 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10013134 [exp] 168 / 5e-52 AT4G21690 242 / 3e-77 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) Lus10008099 [exp] 132 / 5e-39 AT4G21690 137 / 3e-38 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) Lus10011476 [exp] 102 / 7e-27 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10032574 [exp] 84 / 8e-20 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10007818 [exp] 79 / 2e-18 AT1G03400 315 / 9e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017080 [exp] 79 / 6e-18 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 78 / 6e-18 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G033600 [exp] 122 / 1e-34 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.006G247700 [exp] 122 / 1e-34 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.001G176600 [exp] 98 / 4e-25 AT1G15550 452 / 1e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.003G057400 [exp] 95 / 5e-24 AT1G15550 451 / 2e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.010G073100 [exp] 89 / 1e-21 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G135800 [exp] 87 / 3e-21 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G136000 [exp] 87 / 4e-21 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.013G045000 [exp] 86 / 1e-20 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 82 / 2e-19 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 81 / 5e-19 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10013136 pacid=23164194 polypeptide=Lus10013136 locus=Lus10013136.g ID=Lus10013136.BGIv1.0 annot-version=v1.0 ATGGGTATGGCGCCCCACACCGACACTTCGTTGCTCACCCTCGTATACCAAGGCGGCGTCAAGGGTCTCAAAATCTTCCCCGGCGGCGAGTGGGGAATGG TACCTCCGGTTGCTGGAGCAGTGACGGTGAACGTCGGGGATCTCCTCCACGTCATTCCCACCGGCCGGTTTCAAACTGTCCGACACAGGGTGGTGCTTAA GGAGGCTGCGCCGCAAAGGGTTTCGGTTGCATTGTTTTATTTTCCGACGCCGGAGTTTGTTTTGTCGCCGTCGGGGTTGGCCTCCGGCGACGTTGAAGCT CCAGTATTGTATAGGTCGTTGACTGTGAAGGAGTACATAGGGGTCAAGTATAAAAGCTATCAGACTGCACTTGATGCAATAAAAAAATAG
AA sequence Show only first row Show all	>Lus10013136 pacid=23164194 polypeptide=Lus10013136 locus=Lus10013136.g ID=Lus10013136.BGIv1.0 annot-version=v1.0 MGMAPHTDTSLLTLVYQGGVKGLKIFPGGEWGMVPPVAGAVTVNVGDLLHVIPTGRFQTVRHRVVLKEAAPQRVSVALFYFPTPEFVLSPSGLASGDVEA PVLYRSLTVKEYIGVKYKSYQTALDAIKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10013136 [exp]	0	1
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013137 [exp]	1.0	0.9244
					Lus10003450 [exp]	8.0	0.8447
AT3G09920		PIP5K9	phosphatidyl inositol monophos...		Lus10021505 [exp]	14.4	0.8772
AT2G20030			RING/U-box superfamily protein...		Lus10034953 [exp]	15.7	0.8840
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028897 [exp]	24.0	0.8812
AT5G36930			Disease resistance protein (TI...		Lus10006928 [exp]	34.9	0.8534
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10008100 [exp]	45.4	0.8463
AT1G67550		URE	urease (.1)		Lus10015814 [exp]	58.1	0.8448
					Lus10038309 [exp]	58.5	0.8211
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Lus10010201 [exp]	63.2	0.7929

Compare expression of checked genes

Lus10013136 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.