Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72390 67 / 1e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008132 [exp] 114 / 3e-31 AT1G72390 867 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G069200 [exp] 74 / 2e-17 AT1G72390 739 / 0.0 unknown protein Potri.001G165800 [exp] 72 / 2e-16 AT1G72390 778 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013170 pacid=23164142 polypeptide=Lus10013170 locus=Lus10013170.g ID=Lus10013170.BGIv1.0 annot-version=v1.0 ATGGGAATTCCACAGCAGCAGCCTAGCCCGCAGCAAATGGGGCAGAGGACTCCAATGAGCCCGCAAATCAGTTCAGGGGCGATTAACACGGAGGGATGTC CACCGGCCAGTCCACAGTTGAGTTCACAGACAGTTGGGTCCATTGGAAGTATGGCGGTGAACTCTCCAATGGAGCTTCAAGGTGTGAATAAGAGCAACTC TGTTAACAATGCATAG
AA sequence Show only first row Show all	>Lus10013170 pacid=23164142 polypeptide=Lus10013170 locus=Lus10013170.g ID=Lus10013170.BGIv1.0 annot-version=v1.0 MGIPQQQPSPQQMGQRTPMSPQISSGAINTEGCPPASPQLSSQTVGSIGSMAVNSPMELQGVNKSNSVNNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72390			unknown protein		Lus10013170 [exp]	0	1
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10017629 [exp]	6.5	0.9494
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Lus10007511 [exp]	14.9	0.9472
AT1G11340			S-locus lectin protein kinase ...		Lus10041679 [exp]	15.4	0.9325
AT4G14746			unknown protein		Lus10039368 [exp]	16.2	0.9383
AT3G49050			alpha/beta-Hydrolases superfam...		Lus10030391 [exp]	20.6	0.9238
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10035736 [exp]	24.5	0.9470
AT2G03340	WRKY	WRKY3	WRKY DNA-binding protein 3 (.1...		Lus10000173 [exp]	25.3	0.9404
AT1G70420			Protein of unknown function (D...		Lus10030612 [exp]	25.8	0.9431
AT4G16100			Protein of unknown function (D...		Lus10037717 [exp]	27.2	0.8984
AT5G42000			ORMDL family protein (.1.2)		Lus10033219 [exp]	28.1	0.8961

Compare expression of checked genes

Lus10013170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.