Lus10013181 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72430 107 / 8e-31 SAUR-like auxin-responsive protein family (.1)
AT1G17345 105 / 5e-30 SAUR-like auxin-responsive protein family (.1)
AT5G20820 81 / 2e-20 SAUR-like auxin-responsive protein family (.1)
AT3G12955 54 / 7e-10 SAUR-like auxin-responsive protein family (.1)
AT4G34760 46 / 3e-07 SAUR-like auxin-responsive protein family (.1)
AT3G43120 44 / 4e-06 SAUR-like auxin-responsive protein family (.1)
AT2G21220 42 / 7e-06 SAUR-like auxin-responsive protein family (.1)
AT5G20810 42 / 1e-05 SAUR-like auxin-responsive protein family (.1.2)
AT5G50760 42 / 4e-05 SAUR-like auxin-responsive protein family (.1)
AT1G16510 41 / 4e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037443 215 / 3e-73 AT1G72430 114 / 1e-33 SAUR-like auxin-responsive protein family (.1)
Lus10031790 58 / 3e-11 AT3G12955 98 / 8e-27 SAUR-like auxin-responsive protein family (.1)
Lus10012189 44 / 4e-06 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1)
Lus10034507 44 / 6e-06 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10007553 43 / 6e-06 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
Lus10033161 42 / 3e-05 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10024326 41 / 3e-05 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1)
Lus10012432 41 / 4e-05 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1)
Lus10034511 39 / 0.0003 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G071000 114 / 2e-33 AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1)
Potri.006G137000 100 / 6e-28 AT5G20820 135 / 3e-42 SAUR-like auxin-responsive protein family (.1)
Potri.001G164300 93 / 4e-25 AT1G72430 108 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Potri.011G143400 57 / 2e-11 AT3G12955 91 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Potri.001G458000 56 / 1e-10 AT3G12955 86 / 3e-22 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 46 / 2e-07 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 45 / 6e-07 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.002G024300 43 / 5e-06 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1)
Potri.005G237200 42 / 8e-06 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1)
Potri.006G211000 42 / 1e-05 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10013181 pacid=23164195 polypeptide=Lus10013181 locus=Lus10013181.g ID=Lus10013181.BGIv1.0 annot-version=v1.0
ATGGCCAAGGTCGGAAAGCTCACCAAGCTCAAATCCGCAATCAAGAGGTGGCCCTCTTTCACCACCTCCAAGCAACACCATTCATCCTCCTCCTCCTCCT
CCATGGAACGCCGCCACCAGGAAGAAGACTCCGATGATCATCAGAGTCATCATGATCTCCACCAGGTGTATGTCGGGAAGTCGCGGCGGCGGTACCTGCT
GACGTCGGAGGTGATGTGCCATCCCCTGTTTCAGGAACTGATGCAGAGGTCAGGCGGGTTCGATGCAGACGGCAACGTTGTTGTCGGGAGCGAGGTCGTT
CTGTTCGAGCATTTGCTTTGGATGATTAACCAGAATTGCGGCGGCGGGGGAGAGACGGCGGTTTCCGGGCCGATGGAGGATTTGGTCGGTTTCTATTGCT
GCTGA
AA sequence
>Lus10013181 pacid=23164195 polypeptide=Lus10013181 locus=Lus10013181.g ID=Lus10013181.BGIv1.0 annot-version=v1.0
MAKVGKLTKLKSAIKRWPSFTTSKQHHSSSSSSSMERRHQEEDSDDHQSHHDLHQVYVGKSRRRYLLTSEVMCHPLFQELMQRSGGFDADGNVVVGSEVV
LFEHLLWMINQNCGGGGETAVSGPMEDLVGFYCC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72430 SAUR-like auxin-responsive pro... Lus10013181 0 1
AT3G55440 CYTOTPI, ATCTIM... CYTOSOLIC ISOFORM TRIOSE PHOSP... Lus10016538 8.5 0.8550
AT5G24400 PGL3, EMB2024 6-PHOSPHOGLUCONOLACTONASE 3, E... Lus10022352 8.8 0.8646
AT1G49230 RING/U-box superfamily protein... Lus10033515 12.0 0.7828
AT1G20950 Phosphofructokinase family pro... Lus10016047 17.1 0.8401
AT5G37600 ATGLN1;1, GLN1;... ARABIDOPSIS THALIANA GLUTAMINE... Lus10017404 18.7 0.8441
AT1G65980 TPX1 thioredoxin-dependent peroxida... Lus10023662 18.9 0.8532
AT3G58730 vacuolar ATP synthase subunit ... Lus10038979 19.3 0.8250
AT2G25430 epsin N-terminal homology (ENT... Lus10001502 27.7 0.8349
AT4G29040 RPT2A regulatory particle AAA-ATPase... Lus10001313 31.4 0.8465
AT2G30050 transducin family protein / WD... Lus10037571 32.1 0.8380

Lus10013181 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.