Lus10013188 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1)
AT5G61170 258 / 3e-90 Ribosomal protein S19e family protein (.1)
AT5G15520 253 / 3e-88 Ribosomal protein S19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033532 290 / 2e-102 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1)
Lus10020836 287 / 2e-101 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1)
Lus10030702 242 / 1e-83 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1)
Lus10010339 239 / 3e-82 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10000095 239 / 3e-82 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10032992 236 / 2e-81 AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1)
Lus10021865 235 / 3e-81 AT3G02080 216 / 7e-74 Ribosomal protein S19e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G118800 259 / 1e-90 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.015G056100 259 / 2e-90 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Potri.017G092200 256 / 3e-89 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF01090 Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence
>Lus10013188 pacid=23166649 polypeptide=Lus10013188 locus=Lus10013188.g ID=Lus10013188.BGIv1.0 annot-version=v1.0
ATGGCTGCTACAGGCGAAGTTATCAAGGCTGGCACTGTTAAGGATGTCTCACCCCATGAGTTCGTCAAGGCTTATGCCGCTCACCTCAAGCGATCTGGCA
AGCTAGAGCTGCCACCATGGACTGACATTGTGAAGACCGGAAAACTGAAGGAGCTTGCACCTTATGATCCCGACTGGTATTACATTAGAGCTGCCTCAAT
GGCAAGAAAGGTGTACCTGAGAGGAGGCCTTGGTGTGGGTGCTTTCCGAAGAATTTATGGTGGAAGCAAAAGGAATGGAAGCCGCCCTCCCCATTTCTGC
AAGAGCAGCGGTGCTGTTGCTCGCCATATCCTTCAACAGCTAGAGAAGGTCAACATCGTCCAAGTTGATGCCAACGGTGGAAGGAAGATCACTTCAAACG
GGCAGAGGGATCTGGACCAAGTTGCCGGGAGGATTATTGTTGTTGCTCCTTGA
AA sequence
>Lus10013188 pacid=23166649 polypeptide=Lus10013188 locus=Lus10013188.g ID=Lus10013188.BGIv1.0 annot-version=v1.0
MAATGEVIKAGTVKDVSPHEFVKAYAAHLKRSGKLELPPWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFC
KSSGAVARHILQQLEKVNIVQVDANGGRKITSNGQRDLDQVAGRIIVVAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02080 Ribosomal protein S19e family ... Lus10013188 0 1
AT1G74050 Ribosomal protein L6 family pr... Lus10038776 1.0 0.9510
AT1G48830 Ribosomal protein S7e family p... Lus10017497 1.4 0.9380
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10035632 1.7 0.9317
AT1G80560 ATIMD2 ARABIDOPSIS ISOPROPYLMALATE DE... Lus10030344 3.2 0.8962
AT3G02080 Ribosomal protein S19e family ... Lus10030702 4.6 0.9091
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10020794 6.0 0.9100
AT5G48760 Ribosomal protein L13 family p... Lus10011857 6.3 0.9180
AT5G48760 Ribosomal protein L13 family p... Lus10043151 6.9 0.9193
AT1G09690 Translation protein SH3-like f... Lus10030882 10.2 0.8939
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10012883 11.3 0.8704

Lus10013188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.